KEGG   Bifidobacterium longum NCC2705: BL1082Help
Entry
BL1082            CDS       T00094                                 

Definition
(RefSeq) hypothetical protein
Organism
blo  Bifidobacterium longum NCC2705
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 1022620
NCBI-ProteinID: NP_696254
UniProt: Q8G5D2
LinkDB All DBs
Position
complement(913242..914600)
Genome map
AA seq 452 aa AA seqDB search
MVQIHGIRRASADAKYRQMTGQPVKPLILKLCLPAVISNLVTTAYNLTDTFFIGQLGTAQ
SGAIGIAFSIMTVMQALGFFFGNGAGNSMSRELGKQNNERASRLLAVGFAGAVLSGLVIA
TIGLLTLRPLVVMLGSTSTIAPYAVQYLTPLLVAAPCVCGSFALNGLLRYQGQSTFGMIG
LVSGALLNFLLAPLFIFVLHLGIFGAGLATAICQTVSFTILTTMSRKFGVMKLSLRNCRP
DVLLMREVAGGGLPSLIRQGAGSISVTCVNIAANPFGDAAIAGMAIVMRIMLGANSVIVG
LGQGFQPVCGYNYGAGLFARVKEGYWFCVRLATCVLVVLAVLLWVFAPQLVEIFRSDPAV
VAVGVAALHIQCCTVILNGFNMMGNMMTQTMGRTGIASFLALCRQGLFLAPIVLILPMMF
GVLGVEMAQSVSDVLTFLVTIPFMRRILHELR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagattcatggcattagacgcgcaagcgcggacgcgaaatatcggcagatgacc
gggcagccggtcaagccgctgattctcaaactgtgtttgccggccgtcatctccaacttg
gtgaccaccgcctacaatctcacggacacgttctttattggtcagctcggcaccgcgcag
tccggtgccatcggcatcgcgttctccatcatgaccgtgatgcaggcgctcggcttcttc
tttggcaacggcgcgggcaactcgatgagccgcgaactcggcaaacagaacaatgagcgc
gcctcccgactactggccgtgggcttcgcgggtgcggtgctctctggtttggtgattgcc
acaatcggattgctgaccctgcggccgctggtcgtcatgctgggatcgacctcgacaatc
gccccatacgccgtgcaatacctgacgccgttgttggtcgccgcaccctgtgtatgcggt
tcgttcgcactcaacggactgctgcgataccaagggcaatcgacgttcggcatgatcggg
ctggtttcgggcgcattgctgaatttcctgctcgcgccgttgtttatcttcgtgctgcac
ctcggaatttttggtgccggcctggccaccgccatctgccagacggtgagcttcacgatt
ctgaccacaatgagccgcaaattcggcgtgatgaaactgtccctgcgcaattgcaggccg
gatgtgctgctcatgcgcgaagtggccggcggtggcctgccctcgctgatccgccaaggc
gccggttcgatttccgtgacctgcgtgaacattgccgccaatccgttcggcgatgcggcc
atcgccggcatggccattgtgatgcgcattatgttgggcgccaactcggtgatcgtcggc
ctcggccaaggtttccaaccggtgtgcggctacaactacggtgccggcctgttcgcgcgc
gtcaaagaagggtactggttctgcgtgcggctcgccacctgcgtgctcgtggtgttggcg
gtgttgctgtgggtgttcgcaccgcaactggtcgagatcttccgctccgacccggccgtg
gtggcggtgggcgtggccgcgctgcacatccaatgctgcacggtgattctcaacggcttc
aacatgatgggcaatatgatgacccagaccatgggccgcaccggcatcgcctcattcctg
gccctgtgccgacaaggtctgtttttggcaccgatcgtactgattctgccgatgatgttc
ggcgtgctcggcgtggaaatggcgcaatcggtgtccgacgtgctgacattcctagtcact
atcccgttcatgcggcgaatcctgcatgaattgcggtga

DBGET integrated database retrieval system