KEGG   Bifidobacterium longum NCC2705: BL1551Help
Entry
BL1551            CDS       T00094                                 

Definition
(RefSeq) hypothetical protein
Organism
blo  Bifidobacterium longum NCC2705
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-GeneID: 1021720
NCBI-ProteinID: NP_696707
UniProt: Q8G442
LinkDB All DBs
Position
1959123..1960652
Genome map
AA seq 509 aa AA seqDB search
MWSNSVSRKAVTVSEWTVKINGVDRISVKPGECVEIGRKPLRPLADDGNTRLDVADQTKS
MSKRHAMFTVKSNGTASVRDLGSTNGSYVVRENGDLLRLPANAEFLLPTSPMRMQFGDVP
ADFIRVDDPVAKPLDLKVPDLFGYAVHEAPQEPDAADMSVDDILDLRAGEPTAIFSADNV
RRKVDELELGSLNITQPVTKNDEPAIPRDLFADALAQHAEQETERKNQQAMNSVALPKQQ
TEPESTIVTPASKHSRISGIVPVDAIAHAVVKHAPSTSEPAVASAAVVESDVVAGASKSA
ENVQSAPNTRNAGDSQPADTVEQHAEVAQPEAAREAEAAQSENTQPETAQPATAQSETDQ
PAADVPDDQQRTAAEAYQEATAAGVADQQPAAETAQQSVSEAYDIDSTGVHTPVFEPGSV
FERVAKGELKAQEPAVEVDGLTSDEAKTTQDFNVQFEVARHPELLAFLAMNPYLYDDMYS
WLAARGEADIDEALSHNKGYQEYREAVGK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtcaaatagtgtgtccaggaaggcggtcacggtgagcgagtggacggtgaagatc
aacggtgtcgaccggatcagcgtcaagccgggggagtgcgtggaaatcggccgtaagccg
ttacgcccccttgccgatgatggcaacacccgccttgacgtcgccgatcaaaccaaatcg
atgtccaaacggcacgccatgttcacggtaaaaagcaatggcacggcctcggtccgtgat
cttggatcgaccaatggatcgtatgtggtgcgggaaaatggcgatttgttgcgcttgccg
gccaatgccgagttcctgttgccgacgtctcccatgcgcatgcagttcggcgatgtgcct
gcggacttcattcgtgtcgacgatccagtggcaaagccgctcgacctcaaggtgcctgat
ttgtttggctatgcggttcacgaagcaccgcaggagccggatgcggcggatatgtccgtc
gacgatattcttgatttgcgggccggcgagccgaccgccatcttcagcgcggataatgtt
cgacgcaaggtcgacgagcttgaacttggctcgctgaatatcacgcagccagtgacgaaa
aacgatgagccggccataccccgtgatctgttcgcggatgcgttggcccagcatgccgag
caggagaccgaacgcaaaaaccagcaggccatgaactccgtggcactgccgaagcagcag
accgaacctgagtcgacgattgtaacgcctgcatccaagcacagcaggatctccggtatt
gttccagtagatgccatcgcccatgccgttgttaagcacgctcccagcacaagcgagccg
gcagtggcgtcggcggcggttgttgaatccgatgtggtggctggcgcaagcaagtcagcc
gaaaacgttcagtccgctccgaataccaggaatgccggcgattctcagccggcggacact
gtcgaacagcatgctgaagttgcccagcctgaagccgcccgggaagccgaagccgctcaa
tctgaaaacacccagcctgagaccgctcagccggcaaccgcccagtctgaaaccgaccag
ccggcagctgacgtaccggacgatcagcagcggaccgcagccgaagcatatcaagaagcc
accgcagcaggcgtagcagaccagcagccggctgccgaaaccgcccagcagtcggtatcc
gaagcatatgatatcgactccacgggcgtacacactccggtcttcgagcccggctcggtg
ttcgagcgtgtggccaagggcgagctgaaagcacaggagccggcagtcgaagtcgatggc
ctgacctctgacgaggcaaaaaccacgcaagatttcaatgttcaattcgaagtcgcccgt
catcccgaattgctggcgttcctcgccatgaatccgtacctgtacgacgacatgtattct
tggctcgccgcccgtggcgaggccgatattgacgaagccctgtctcacaacaagggctat
caggaataccgcgaagcggttggaaagtga

DBGET integrated database retrieval system