KEGG   Bifidobacterium longum NCC2705: BL1552Help
Entry
BL1552            CDS       T00094                                 

Definition
(RefSeq) hypothetical protein
Organism
blo  Bifidobacterium longum NCC2705
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTES_1575
Motif
Other DBs
NCBI-GeneID: 1021721
NCBI-ProteinID: NP_696708
UniProt: Q8G441
LinkDB All DBs
Position
1960661..1964284
Genome map
AA seq 1207 aa AA seqDB search
MTQSQTQNQNLTEGLNRIRRWRDQYRSMQPPSPLEDVNQLAAKLEMTHAHPSGIAQLFAS
GHVRLDSLFRDTGVLKAAERHIGRVLDDQAAKRRISGVAELSLVVGVATWKGNALPVLLY
PVSVTIEGDGLSTTIRFTGRVALNVAFVNTLREQGVFLDEDSLFDGASYDSGTPETSAMF
ARISSEASERISDFAIERQIVLGCFMDPSSQMISESRQFIDQLENGPTGNVLLDALAGDE
SARTALKDANIPQYSPFDVDPHAEYEVGDVDNTVRYAASLAANGHSIVVDGTFPKGTAEQ
AVAIASRCLMNGRSVLYVPGVAEQKRLFIQTASANEMKAQVLDVSDEHANAALDKQLIAA
VGFQPGVATQRFDQLADELVGVRSRLTRYLGDLHGGNDKWNVSAYETIQNLARISVLPTH
PATHVRLDESSALSIANDIDTWIGKMERAGELGEYTIGPEDTAWYKASITTEEQAVTAYQ
RVDDLLRRFLPATREQVARTVQTCGFPVPPTTREWERQVTVLKNLRRVLDVFQPEIFERD
ISSMIEATKPKSQRKAEGTSMGFWERRRHIKEAKDLLRVGAQVEDLHEALKVVAKQGEQW
HQFVPHGGWPVLPSKLDEIISTQEALVSNMTALDTVLSTTPAGGNLETADFEKVEARLKA
LLDDRKALDTLPERCLLEQEFASAGLNELVADLNARRVSVEQVRGEVQLAWWTTVFEDIV
RSSAIISNQDGAALQAASDRFAQVDVEHVRSIGPMVSQESMRRLCDMLFSRTQEANQMHT
VLAGRASVSLSRIRRDHPEILAAAKPILVAAPGTLAALTEPGVLADVAILDACAHIPAIE
LLSIIGRVQQVVVIAHCATVTSESVKQLIDTLPHIEVDAAPSRRAPRLSAFLESEGYGPV
RYDVATEPAAGEVRFHRVEASGVPVMSSGLVESSQPEIDEVVRLITQRAAGFAVVPSSYR
LVVVMLTDAFRTRLGAELKSLAGKSKAMGRFLRHVRLVSLRDVAGGRATDVILSMCYAKT
THGRLLQQFGPLESTGGRGLLLDALALADHSLDIVSAFGSEDLDEERLHQSGPRFLKTML
TWAEQLDDRPVLPLRDAAGGNVLFDDIADRLRARGLNAAVDYGFDKGVKIPLVVGLKDKP
FALAVQTDDANFMSVQSTRRRHRLSAQDLISLGWNVMTVWSVAAFVNPDKEVDRIVSRIG
EIYREVE
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atgacccagagccagactcagaaccagaatctcacggaaggtctgaatcgcatccgtcgc
tggcgtgaccaataccgcagcatgcagccgccatcgccgctcgaggatgtgaatcaactg
gccgcgaagctggagatgacccatgcccatccctccggcatcgcccagctgttcgcttcc
ggccatgtccggttggattcgttgttccgcgacacgggtgtgcttaaggccgccgaacgc
catattgggcgcgtgctggatgaccaggccgccaaacgcaggatttccggcgtggcggag
ttgtcgctcgtggtcggcgtggccacatggaagggcaacgcgctgccggtgctgttgtac
ccggtgagcgtcacgatcgagggtgatggcttgtcgaccaccattcgattcaccggtcgc
gtggccctgaacgtcgcgttcgtcaatacattgcgtgagcagggggtgttcctggatgag
gattccctgtttgacggtgccagctatgacagtggcactcccgaaacttccgcgatgttc
gcccgtatttcgtccgaagcgtcggagcgtatctccgacttcgccatcgagcgccagatt
gtgctcggatgcttcatggacccctcgtcgcagatgatcagcgaaagccgacagttcatc
gaccagctggagaacggccccaccggcaatgtgctgttggacgcgcttgccggcgacgaa
tccgcccgcaccgcgctcaaagatgccaatattccgcaatacagtcctttcgacgtagac
ccgcatgccgagtacgaagtcggcgatgtggacaatacggtgcgatatgccgcgtcactt
gctgccaatggccatagcatcgtggtcgacggcaccttcccgaagggcaccgcggagcag
gctgtggccatcgcatcgcgctgcctgatgaatggtcgttccgtgctgtacgtgcccggc
gtggccgagcagaagcgtctgttcatccagacggcttccgccaatgagatgaaggcgcag
gtactggatgtatccgatgaacacgccaacgccgcgcttgataagcagctgattgccgca
gtcggattccagcccggagtcgccacccagcgattcgaccagctggccgacgaactcgtg
ggcgtgcgctcgcgcttgacccgctacttgggcgacctgcacgggggcaatgataagtgg
aatgtgtccgcatacgagaccattcagaatctggcccgtatctccgtgctcccgacgcac
cctgccacccacgttcgacttgacgagtcaagtgccctgagcatcgccaacgatattgac
acatggatcggcaagatggaacgcgccggcgagctcggcgaatacaccatcggcccggaa
gacaccgcatggtacaaggcgtccatcaccactgaagaacaggcagtaaccgcctaccag
cgcgtggacgatttgctgcgtcgcttcctgcccgccacccgtgagcaggtggcacgcacc
gtgcagacctgcggattcccggttcctcccaccacccgcgagtgggagcgtcaggttacg
gttttgaagaatctgcgacgagtgcttgacgtgttccagccggagattttcgagcgagac
atcagctccatgatcgaggccaccaagccgaagagccagcgcaaggccgagggcacgtcg
atgggattctgggagcgccgccgccacatcaaggaagccaaggatctgctgcgcgtcggc
gcgcaggtcgaggacttgcacgaagcgttgaaggtagtcgccaagcaaggggagcagtgg
catcagttcgtgcctcacggcggttggccggtgctgcccagcaagctcgacgagatcatc
tccacccaagaggcgctggtcagcaatatgaccgcgctggataccgtgctttccaccaca
cccgctggtggcaatctggaaaccgccgatttcgagaaggtggaagcacgcctgaaagca
ctgctggatgatcgcaaggcactggacaccttgccggagcgttgcctgctggagcaggaa
ttcgcctctgccggactgaacgaactggtcgccgatctcaacgctcgccgagtgagcgtg
gagcaggtgcgcggcgaagtgcagctggcctggtggaccaccgtgtttgaggacattgtg
cgttcgtccgccatcatctccaaccaggatggtgccgcgctgcaggccgcatccgaccgc
tttgcgcaggtcgatgtggagcacgtgcgctccatcggaccgatggtgtcgcaggaatcc
atgcgccgcctgtgcgacatgctgttctcccgcactcaggaagccaaccagatgcacacc
gtgctggcagggcgcgccagtgtgtcgctgagcaggattcgccgtgatcatccggagatt
ctggccgcggccaagccgattctggtggccgcgccgggtacgctcgccgcactcaccgag
ccgggtgtgctggctgatgtggcgattctcgatgcgtgcgcgcacattcccgctatcgag
ttgctgtccatcatcggccgcgtgcagcaggtggtggtgatcgcccactgcgcgacggta
accagcgaaagcgtcaagcagctgatcgacacgttgcctcatatcgaggtggatgctgcc
ccatctcgccgtgcgccgcgcctgtccgcattccttgaatccgagggatatggtcctgtt
cgctatgatgtggccaccgagccggctgccggtgaggtgcgattccaccgtgtggaagcg
agcggtgtgccggttatgtcttctggtctggtggaatccagccagccggagattgatgaa
gtggtgcgtctgattacgcaacgtgccgccggttttgccgtggttccttccagctatcga
cttgtggtcgtgatgttgaccgacgcattccgcacacgcttgggtgccgaattgaagtcg
ttggcaggcaaatccaaggcgatgggccgattcctgcgccatgtgcggttggtttccttg
cgtgacgtggccggaggtcgtgccactgacgtgattctgtcgatgtgctatgcgaaaacc
acgcacggacgtctgcttcagcagttcggcccgctcgaaagcacaggcggtcgcggactg
ttgctggatgccctggcattggcggaccacagcttggatattgtgtcggcctttggttcc
gaagatttggacgaagaacgactgcaccagtccggtcctcggttcctgaagaccatgttg
acgtgggccgaacagcttgacgaccgtccggtgcttccgttgcgtgatgcggcaggcggc
aacgtgctgttcgacgatatcgccgacaggttgcgcgcgcgaggactgaacgctgctgtt
gattatggattcgacaagggcgtgaagattccgctcgtggtgggattgaaggacaagccg
tttgccttggccgtgcagaccgatgacgcgaactttatgtccgtgcaatccacgcgtagg
cgtcatcgtttgtcggcacaggatctcatttccttgggctggaatgtgatgaccgtctgg
agtgtcgccgccttcgtgaaccccgataaggaagtcgaccgtatcgtcagccgtatcggt
gagatctatcgcgaggttgaataa

DBGET integrated database retrieval system