KEGG   Bifidobacterium longum NCC2705: BL1553Help
Entry
BL1553            CDS       T00094                                 

Definition
(RefSeq) hypothetical protein
Organism
blo  Bifidobacterium longum NCC2705
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAF ChapFlgA RcpC
Motif
Other DBs
NCBI-GeneID: 1021722
NCBI-ProteinID: NP_696709
UniProt: Q8G440
LinkDB All DBs
Position
complement(1964582..1965244)
Genome map
AA seq 220 aa AA seqDB search
MRLRKTSGHHGCMVTFSFIKPPARGSLRRRRMADALRRLTAALCVGLAVLFGLEAVLAVV
ETEPMVVAARSIRRGDIILAADVQLADMPVSAIGPSWACNIEDVVGKVAQIDIEAADPIS
THMARDAPVAPTGTTVIEVRLASSVDDVLAGDQVRLVSAVGCEGADCTLAENATVMNVDK
PDTTGALGSNDRLVSFAMPPEAAAKVMELQQAGAIMAVVR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcttacgaaaaacttcaggtcaccatggttgcatggtgaccttttcgtttattaag
ccgcctgcgcgcggctcattgcggcgacggcgcatggcggatgccttgcgccgactcact
gctgcgttgtgcgtgggactcgcagtgctgtttgggcttgaagccgtattggccgtggtg
gagaccgagccgatggtggtggccgcccgctcgattcgacggggtgacattattctggcc
gccgacgttcagttggctgatatgccggtatctgcgataggcccgtcttgggcgtgcaat
attgaggatgtggtgggcaaggtggcgcaaatcgatatcgaagcagccgatcccatttcc
acgcatatggccagagatgcgcccgtagcaccgaccggcactacggtgattgaagtccgc
ttggccagtagcgtcgacgatgtattggccggcgatcaggtgagactggtttccgccgtc
ggttgcgaaggtgccgattgcacgctggccgagaacgccacggtgatgaatgtcgacaaa
ccggatacgactggcgcattgggaagcaacgaccgactggtgtcgttcgcaatgccgccg
gaggccgcggccaaggttatggagctgcaacaggccggagcgattatggccgttgtgcgg
tag

DBGET integrated database retrieval system