KEGG   Bifidobacterium longum NCC2705: BL1555Help
Entry
BL1555            CDS       T00094                                 

Definition
(RefSeq) hypothetical protein
Organism
blo  Bifidobacterium longum NCC2705
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-FTHF_cyc-lig
Motif
Other DBs
NCBI-GeneID: 1021724
NCBI-ProteinID: NP_696710
UniProt: Q8G439
LinkDB All DBs
Position
complement(1965738..1966487)
Genome map
AA seq 249 aa AA seqDB search
MCGMSEVGSGMNIGSDYSGTEKTEKTDKATLRHHILSRRKRVPAEERGAAGELLVRRFPA
HMIQDGPTVAAYVSMGSEIETRPLLRWLRAHGCHVLVPRLGSGLEIGWSVLDSLESLRSM
DAVGGANNAGSCSSPSTVHHRPDEPTGAVLPPEALEKADLVIAPALAVDPQGNRLGRGAG
WYDRALARRKPACPLIAVCWPWEVLDIDLPAEPHDVPADGVLTPEGYRRLSSSGLLSWPA
GQDTRRKPD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcggtatgagcgaagtgggcagtggcatgaatatcggcagcgactacagcggcaca
gagaaaacagagaagacggataaagcgacgctgcgccaccatatactgtctcggcgcaag
cgcgttccagcggaagaacgcggagcggccggtgaattgctggtgcgacggttcccagca
cacatgattcaggatggtcccacagtggcggcatatgtgtcgatgggttcggaaatcgaa
acccggccactgttgcgatggctgcgggctcatggctgccacgtgttggtgccaaggttg
gggtctgggttggaaattggctggagtgtgctggattcattggaatcattgcgctcgatg
gatgcagtgggtggcgcgaacaatgccggtagctgcagctctcccagcaccgtccatcac
agacccgatgagccaactggcgcagttctaccgcccgaagcgttggagaaggccgatctg
gtcatcgctccggctttggcagtggacccgcagggcaatcgtctggggcgtggagccggc
tggtatgaccgggccttggctcgccgcaagcccgcatgtcccctgattgcggtgtgctgg
ccgtgggaggtgttggacattgatttgccggccgaaccacatgatgtgccggccgacgga
gtgctgacgccggagggataccggcggcttagctcatcgggcctgttgagctggccggcc
ggccaagatactcggcgcaagccagactga

DBGET integrated database retrieval system