KEGG   Bifidobacterium longum NCC2705: BL1557Help
Entry
BL1557            CDS       T00094                                 

Definition
(RefSeq) hypothetical protein
Organism
blo  Bifidobacterium longum NCC2705
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ESCRT-II Clr2 FA_desaturase
Motif
Other DBs
NCBI-GeneID: 1021727
NCBI-ProteinID: NP_696712
UniProt: Q8G437
LinkDB All DBs
Position
1967290..1968714
Genome map
AA seq 474 aa AA seqDB search
MGYESLSTVVVLVIVAIIIVVWLPVRTANGMKRVDEHRQDRYSPSLHIVDAENGRRFGDI
KPHKAKGAAMPASTPSARLTSEHIAHVRELRRAAIRRRQILAVCLLAITVLVFAVSFPLH
FSPLLALIPFVLLLLVLVLGANASRQARQWERKVVRYERAHSGTGWSKKPSAESKDSKRV
NKAEPVAAVTAPAEKPAEQIEDAATEVMEQRQIRRALRDAEIEQAKAKALRQSAAAYQAA
EEHAKQSEKSDIAQSAADKPAAEPSAMVDESADRKSAAETSESSATPDASVRTDKSIESD
KSVAPRVEPSLTVRDERDERDDAAAAADATSELVSVRPARALDVFDMSTSQDLISFTLGG
EHNADNAPESLEIKSTRQVSKAEPVEPAVAEKLIDEARAVKAADDAKAVSAGNAVDTEPE
QRDDADTDADDEAANAAQRAAFHESEERADVEAPAATTDSLGAGLDSILARRGN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgagtcactgagcactgtcgtcgtgctggtgattgtggcgattattatcgtt
gtatggctgcccgtacgtacggccaacggcatgaaacgtgtggacgagcaccggcaggat
cgttattcgccttccctgcatatcgttgatgcagagaacggcagacgattcggagacatc
aagccgcataaggcgaaaggggcagcaatgccagcatcaacaccgtcagcgaggctgaca
tctgagcacatcgcccatgtgcgggaactgcgccgcgcggccatccgccgccggcagatt
ctcgccgtatgcctgcttgccataaccgtgttggtgtttgccgtatcgttccccctgcat
ttcagtccgctgcttgctcttattccgttcgtgctgttgctgctggtgctggtgctggga
gccaatgcctcacgccaggcccggcaatgggagcgcaaggtggtccgctacgagcgggct
catagcggtacgggctggtccaagaaaccgtctgccgagtccaaggacagcaagcgtgtg
aacaaggccgaaccggttgcggccgtaactgcgcctgccgagaagcctgccgagcagatt
gaggatgctgccaccgaggtcatggaacagcggcagattcgccgcgcgttacgcgatgcc
gagattgagcaggccaaggccaaggcgttgcgtcagtccgccgccgcatatcaggccgcg
gaagagcacgccaaacagtctgagaagtctgatattgcacagtccgccgccgataagcct
gccgccgagccgtctgctatggtcgatgaatccgccgaccgtaagtccgctgccgaaacc
agcgaatcttccgccacacctgatgcctccgttcgcacagacaagtcgattgagtcggac
aagtccgtcgcccctcgagttgaaccatcgcttacggtgcgtgacgagcgcgatgagcgc
gacgatgccgctgccgctgccgatgccacgtcggaactggtcagcgtacgccctgcccga
gcactggacgtcttcgatatgtccacctcgcaggatctcatctccttcactttgggtggg
gaacataacgccgacaacgctccggaaagcttggagatcaagtcgacccgtcaggtgtcc
aaggcggaacctgtcgaacccgcagtggcggaaaagttgattgacgaggcccgagccgtc
aaggccgcggacgacgccaaggctgtcagcgccggaaacgctgtagacactgagccggag
cagcgcgatgatgccgatacggacgccgatgacgaggctgcaaacgccgcccagcgagcc
gcattccacgaatccgaggagcgtgccgacgtcgaagcgccagcggcgaccaccgattcg
ttgggcgcaggcctggactccattcttgcccgccgcggcaactga

DBGET integrated database retrieval system