KEGG   Bifidobacterium longum NCC2705: BL1558Help
Entry
BL1558            CDS       T00094                                 

Gene name
groES
Definition
(RefSeq) co-chaperonin GroES
  KO
K04078  chaperonin GroES
Organism
blo  Bifidobacterium longum NCC2705
Brite
KEGG Orthology (KO) [BR:blo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:blo03110]
    BL1558 (groES)
   03029 Mitochondrial biogenesis [BR:blo03029]
    BL1558 (groES)
Chaperones and folding catalysts [BR:blo03110]
 Heat shock proteins
  HSP10
   BL1558 (groES)
Mitochondrial biogenesis [BR:blo03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    BL1558 (groES)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10
Motif
Other DBs
NCBI-GeneID: 1021729
NCBI-ProteinID: NP_696713
UniProt: Q8CY47
LinkDB All DBs
Position
1968887..1969180
Genome map
AA seq 97 aa AA seqDB search
MSIKLTPLEDKIIVKQAEAQTQTASGLYIPDNAKEKPQQGEVLAVGPGRRDDKGERIPMD
VKVGDKVLYSKYGGTEVHYEGEDYLIVGARDILAILG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgattaagctcacaccgttggaagacaagatcatcgtcaagcaggccgaggcccag
acccagaccgcttccggtctgtacattccggacaatgccaaggagaagcctcagcagggt
gaagtcctggccgttggcccgggccgtcgtgacgacaagggcgagcgcatcccgatggat
gtcaaggtcggcgacaaggtgctgtactccaagtacggcggcaccgaagtccactacgag
ggtgaggactacctcatcgtcggcgcccgcgacattctcgccatcctcggctga

DBGET integrated database retrieval system