KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0056Help
Entry
BLIJ_0056         CDS       T02092                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
blon00620  Pyruvate metabolism
blon00680  Methane metabolism
blon01100  Metabolic pathways
blon01120  Microbial metabolism in diverse environments
blon01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:blon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLIJ_0056
  09102 Energy metabolism
   00680 Methane metabolism
    BLIJ_0056
Enzymes [BR:blon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BLIJ_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAJ67651
LinkDB All DBs
Position
complement(66258..69011)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPESLKYDMDLCLEILRNVLGEYNPELLSTF
DTVRHYAVEASAEHFAELKDPNPDQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVSVDQAVDPINELTVAYHQLINETGPAKAKELLNQLEFHPVFTAH
PTEARRKAVEGKIRRVSELLEEYKRLGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFNTIPKVYRRFDDWVLGDKAGLVEPACPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEEATRTVGRNLTMEAETTPPSAELKSLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDDFLADLKVVQRSLAAAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGELQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTEMTERYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIARMYLALGDREDLNEKVLNEMELTRKWV
LAIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgaagaacagatcactcccgctgacgccgccatcgtcactaccgggacc
ggccgaaagggcccggaggagcatgatcttcccgaaagcctgaagtacgacatggatctg
tgtcttgagatcctgcgtaacgtactgggcgaatacaaccccgaactgctgtctacgttc
gacaccgtgcgtcattacgcggtggaggccagcgccgagcatttcgccgagctgaaggat
ccgaaccccgaccaggatggcctgaaggaggccgtgaacgtcatcgacaacatgacgttg
cacgacgcccagctgctggcccgcgcgttcgccacgtatttccatctggcaaacctgtcc
gaggagaactaccgtgtttccgtgctccacgagcgcgagaacaacgtgtccgttgaccag
gcggtcgacccgatcaacgagctcaccgtcgcctaccaccagctcatcaatgagactggc
ccggccaaggccaaggaactgctcaaccagctcgaattccaccccgtcttcacggcgcac
cccactgaggcccgtcgtaaggccgtggaaggcaagatccgccgcgtttccgaattgctt
gaggagtacaagcgcctcggcggctcggataagaaggaatgcctgcgccgtctctacaac
gagatcgacgccctgttccgcacctctccgatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttcaacaccatccccaaggtc
taccgtcgcttcgacgactgggtcctgggcgataaggccggtctcgtcgagcccgcttgc
cccgcgttcttccacccgggcagctggatcggctccgaccgcgacggtaacccgaacgtc
accgccaaggtgagccgcgccgtggcccgcaagttctccgatcacgtgatcgccgccctt
gaggaagccacccgcaccgtgggccgcaacctcacgatggaagccgagaccacgccgcca
agcgccgagctcaaaagcctctggagccaccagaaggaaatgagcgagcgcctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgat
cgtctgcactacaccatcgagcgcgatgccgacctcatgtaccactcctgcgacgacttc
ctcgccgacctcaaggtggtccagcgttcgctggccgccgccggtgccaagcgttccgct
tacggcccgctgcaggatctgatctggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactccgtggtgcacgcccgcgcccttgcggatatccgcgagcac
ggcctgcacggcgagcgcggcgaactgcagccgatgacgcacgaggtgctcgacaccttc
cgcgccctcggtgccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgcttggccttc
tcccacccggaggacgtgcccaccatcgacgtgatcccgctgttcgagcagcttgaggat
ctgcagaactcggtggacgtgctcgaggaaatgatcaagatccccgaggttcaggctcgt
ctgaaggccaccggcaacaagctcgaggtcatgctcggctactccgactcctcgaaggac
gccggcccgacctccgccacgctggccctgcactccgctcaggagcgcatcgccaaatgg
gctgagtcgcacgacatcgacctgaccctgttccatggccgcggcggtgccgtcggtcgt
ggcggcggccccgccaaccgcgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgagcagggcgaggtcatcttcgcccgttacggcaacccggtgctggcc
atccgccacgtcgagtccgtggctgcggcgaccttgctgcagtccgcgccgagcgtggag
aagcgcaacaccgagatgaccgagaggtacgccgacatggccgctcagctcgacgaggcc
gcgcacaaccgtttcctcgacctgttgaacaccgatggcttcgctccgtggttctcgatc
gttacgccgctgaccgaaatcggcctgctgccgatcggctcccgcccggccaagcgtggc
ctcggcgccaagtcgctcgacgacctgcgtacgattccgtggatcttctcctgggcccag
gcccgcatcaacctggccgcttggtacggtctcggcaccgcatgcgagaagttcggcgat
ctggagaccatgcgtcaggcttacgaggaatggccgctgttctccacgttcatcgacaac
atcgagatgtccatcgccaagacggatgagcgcatcgccaggatgtaccttgccctcggc
gaccgcgaggacctcaatgagaaggtgctcaacgagatggagctcacccgcaagtgggtt
ctggccatcgtgggtgacaagtggccgctgcagcaccgtcacgtgctcggccaggccatc
cgcatccgctccccatacgtggacgcgctgtccgtcactcaggtgctggcgctcaagtcg
ctgcgcaagaaggtggacaaggaagagctctcgcagagccaacaggccggattcatctac
ctcatcctgtgcaccgtctccggcgtcgccgcgggcctgcagaacacgggctga

DBGET integrated database retrieval system