KEGG   Blattabacterium cuenoti: BPAA_185Help
Entry
BPAA_185          CDS       T02525                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
blp  Blattabacterium cuenoti
Pathway
blp00564  Glycerophospholipid metabolism
blp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BPAA_185 (glpD)
Enzymes [BR:blp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BPAA_185 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Thi4 GIDA HI0933_like Lycopene_cycl Pyr_redox_3 NAD_binding_8 Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAM99482
UniProt: M4ZS23
LinkDB All DBs
Position
complement(196739..198337)
Genome map
AA seq 532 aa AA seqDB search
MMKNFLNRDRFLTILENVNIWDVIIIGGGATGLGIALDSSSRGYKTLLLEQSDFSKATSS
RSTKLVHGGVRYLAQGNIRLVYEALQERGFLLKNAPHLVKKQKFIIPVFNWKMGILYWTG
LKLYEWLSGSLSFGKSRFLSKDEIVRNFPEIKSKELKGGILYYDGQFDDARLAINLAQTC
VQKGGILLNYFQVENLLKKVGNKISGVVACDLETQKKYSISSKIVINATGVFSDSISKMD
ESACPIFIKPSQGTHIVLDKSFFSSSNAIVIPKTQDGRILFCVPWHDHVLVGTTDTFLEK
SVLEPIPLEEEIDFILQTFNKYFVFHTKKSDILSAFSGLRPLFVSNNSYFSTKTKDISRS
HKLMISSSGLISIIGGKWTTYRKMAEDTVNKAIEIGKFNKIPSVTKNLKIYGSDFSYKSQ
NSHWNKYGEDEYHIKKLIDKDPLLGASLVSKNSSSYTEAEVIWMVRYEMARTIEDVLARR
FRLLFLNAKKAIDIAPKVASLMAQELSRDEKWEKSQVESFKELAMRYYYPSV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaattttttaaatagagataggtttttgactattttagaaaatgtaaatatt
tgggatgttatcataattggaggaggagctacaggattaggaatcgctttagattcttct
tccagaggatataagactcttctattagaacaatctgatttttctaaagccacttctagt
cgaagtacgaaattagttcatggaggagtacgatatttagctcaaggaaatataagatta
gtttatgaggcattgcaagaaagaggttttttattaaaaaatgctcctcatttagtaaaa
aaacaaaaatttatcattccagttttcaattggaaaatggggattttgtactggactgga
ttaaaattgtacgaatggctttctggttctttaagttttggaaaatccagatttttatcc
aaggatgaaattgttagaaattttccagaaattaaaagtaaagagttaaaaggaggtatt
ttatattatgatgggcagtttgatgacgcacgtttagctataaatttagcacaaacttgt
gttcaaaagggtggaatattattaaattattttcaagtcgaaaatttactaaaaaaagta
gggaataaaatttctggagttgtagcctgtgatcttgaaactcaaaaaaaatattctatt
tcttcaaaaatagttatcaacgctactggagtattttctgattctatttcaaaaatggat
gaatctgcatgtccaatttttatcaaaccaagtcaaggtacacatattgtattagataaa
tcttttttcagtagttcaaatgctatagttattccaaaaactcaggatggaagaatttta
ttttgtgttccatggcacgatcatgttttagtaggaactacagatacttttttagaaaaa
agtgttcttgaaccgattcctttagaggaagagattgattttatattacaaacttttaac
aaatattttgtatttcatacaaaaaaaagtgatatattaagtgcattctctggattacgt
cctctttttgtttctaataattcttatttttctactaaaactaaggatatttctagatct
cataaacttatgataagctcttctggactaattagtattataggaggaaaatggactaca
tatagaaaaatggcagaagatactgttaataaagctattgaaataggtaaatttaataaa
ataccttctgtaacaaaaaatcttaaaatttatggatctgatttttcatataaaagtcag
aattctcattggaataaatatggagaagatgaatatcatataaaaaaattaattgataaa
gatccattattgggggcatccttagtttccaaaaattcttcttcttataccgaagcagaa
gtcatttggatggttcgttatgaaatggcgagaaccattgaagatgttttagcaagaagg
ttccgtttattatttttaaatgctaaaaaagcaatagatatagcacctaaagtagcatca
ttaatggctcaagaactttctagagatgaaaaatgggaaaaatcacaagtagagtctttc
aaggagctagctatgcgatactattatccatcagtttga

DBGET integrated database retrieval system