KEGG   Salinivirga cyanobacteriivorans: L21SP5_00992Help
Entry
L21SP5_00992      CDS       T04172                                 

Definition
(GenBank) Retaining alpha-galactosidase precursor
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
blq  Salinivirga cyanobacteriivorans
Pathway
blq00500  Starch and sucrose metabolism
blq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L21SP5_00992
Enzymes [BR:blq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     L21SP5_00992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C LPAM_1
Motif
Other DBs
NCBI-ProteinID: ALO14659
UniProt: A0A0S2HX64
LinkDB All DBs
Position
complement(1200288..1202354)
Genome map
AA seq 688 aa AA seqDB search
MKKYILGLLIVTMLHACIKTDSQMIIQSPDGKIEVKLDLKNNQLPKYAVTYERDTVIKPS
SMGFEFLNQPEMAGFRVVDTRMKSVNKKWTMPWGEQKEVVNHYQEMLVSLQEIKKPKRSM
NIRFRVFAEGIGFRYEFPEQPGLDSLEISAENTEFCLTGDHRVWWIPGDWDIYEHLYNET
LFSEIDALQFAQHESLAQTYIPYNAVNTPVTMRTASGLLLSFHEAALTNYPGMTLRVDTE
NLTMRSELVGSERTEYKAKVSLPFETPWRTIQIAPDATDLIASKMILNLNEPNKLGDVSY
VKPMKYAGIWWEMHLDKSTWDLASGRHGATTENAKRYIDFAAENNLGGILVEGWNTGWEK
WIGVDDREGIFDFVTPYPDYDINEVVLYAKSKGVEIIMHHETSAAVTTYEQQLDTAYQFM
ESLGLHAVKTGYVGTIIPKGEYHHGQYMVQHYRKVLETAAQHKVAVNAHEPIKATGIRRT
YPNAISREGLRGQEFNAWSSDGGNPPSHLPTVAFTRMLAGPIDFTPGAFNLKLEPYKPNN
QVSTTLAQQLALYVVIYSPVQMACDLPEHYDGRPAFQFIRDVGVDWQQTEVLNGEVGEYV
TIARKEKETGNWFLGSITDEHAREFALPLNFLDKDVTYEATLYKDAPDAHWDDNPESINI
ETHTLQATDTLNVQLAPGGGLAVSFIKK
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacattttaggtcttttgatcgttaccatgctgcacgcatgcataaaaaca
gatagtcaaatgattatacaatcacccgacggaaaaattgaagtgaaactcgatttgaaa
aacaaccaactacctaaatatgcggtcacctatgagcgcgataccgttattaaaccttct
tcaatgggatttgagtttcttaatcagcctgaaatggccgggtttagggtagtagatacg
cggatgaagtctgtcaataaaaaatggactatgccatggggtgagcaaaaagaggttgta
aaccactaccaggagatgttggttagcctgcaagagattaaaaaacctaaacgctcaatg
aatattcgcttccgggtatttgccgagggcattggctttcgctatgagtttcccgaacaa
cccgggctcgattcactcgaaatatctgcagaaaatactgaattctgccttacaggtgat
catcgcgtgtggtggattccgggagactgggatatttatgaacatctgtataacgagacg
ctgttttcagagattgatgccctgcaatttgctcagcatgaatcgctggcgcaaacctac
ataccctataatgccgtaaatacgccggtaaccatgcgtacagcaagcggattacttctg
agctttcatgaggctgcactgaccaattatccggggatgacactccgggtcgatacagaa
aacctcaccatgcggagcgaacttgttgggtcggaacgcactgaatataaagctaaagtg
agtttgccatttgaaacgccctggcgtaccatacaaattgcccccgatgcaacggatctg
attgcttctaaaatgattttgaacctgaacgaacccaataagctgggtgatgtgagctac
gtgaaacctatgaaatatgctggcatttggtgggaaatgcacctggataaatcgacatgg
gatttggccagcggccggcacggagctacaactgagaatgccaagcgctacatagatttt
gcggctgaaaacaacctgggtgggatactcgtagaaggttggaacaccggctgggagaaa
tggattggtgtagacgaccgtgaggggatttttgattttgtgacgccatatccggactat
gacattaatgaggtagtactttatgccaaaagtaaaggtgtggaaattattatgcaccat
gaaacatcggctgcggtgaccacttatgagcagcagctcgatacagcctaccagtttatg
gagtctttgggattgcatgccgtaaaaaccgggtacgtgggcacgatcattcccaaaggg
gagtatcatcatggacaatacatggtgcaacattaccgtaaggtactggaaacagcagcg
cagcacaaggtcgctgtaaatgcacatgagccgatcaaggccacgggtattcgccgtacc
tatcccaatgccatttcacgtgaaggtctgcgcggacaggaattcaacgcatggtcgtcc
gatggtggtaacccaccctcgcatttgccaactgtagcctttacacgtatgctggcaggg
cccatcgactttactcctggagctttcaatttaaagctggaaccgtataaacccaacaac
caggtaagtacaacactggcacagcaactggcactttatgttgtaatttacagtccggtg
caaatggcctgcgacctgcctgaacattacgatgggcgacctgcctttcagtttattcgt
gatgtgggggtggattggcagcaaacagaagtactcaacggagaagtgggtgaatatgtg
accattgcccgtaaggagaaagaaaccggtaattggtttctgggcagcattaccgatgaa
catgcccgcgagtttgcattgccgcttaattttcttgataaggatgttacttatgaagcg
acattgtataaagatgcgcccgacgcgcattgggatgataaccctgagtccatcaatatt
gaaacacatacacttcaagctaccgatacattgaatgtccaattagccccgggtggcgga
ttggctgtatctttcataaaaaaataa

DBGET integrated database retrieval system