KEGG   Salinivirga cyanobacteriivorans: L21SP5_01391Help
Entry
L21SP5_01391      CDS       T04172                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
blq  Salinivirga cyanobacteriivorans
Brite
Enzymes [BR:blq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     L21SP5_01391 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALO15041
UniProt: A0A0S2HY75
LinkDB All DBs
Position
complement(1676240..1676806)
Genome map
AA seq 188 aa AA seqDB search
MSIIMKNVFWGVAMIAIFGACSTAPEKATQDHKHEKSQAIIEKANCVVHPTEGNDVNGTI
AFEKTTDGVKVTADVAGLTPGKHGFHVHQYGDCSGPAGKTAGGHFNPEGKKHGAPDDMER
HVGDLGNLVADSSGVASMTFTDSKLTLNGPNSIIGRSIIIHAGEDDLTSQPTGAAGARVA
CGVIGVAK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataattatgaagaatgtattttggggtgtggctatgatagccatttttggtgca
tgtagtacagccccggaaaaagcaacacaggatcacaaacatgaaaaatcgcaagctata
attgaaaaagctaattgtgtagtgcatcccaccgagggaaatgatgtgaatggtacaatt
gcgtttgagaaaaccactgatggagtaaaagttacagctgacgtagcaggtctcacaccc
ggaaagcatggttttcatgtgcatcaatacggtgattgcagtggtccggctggaaaaact
gctggagggcactttaatcctgaaggtaagaaacatggagccccggatgatatggaacgc
catgtgggcgaccttggaaacctggtcgcagacagttccggcgtagcttcaatgactttt
acagattctaaattaactctaaacggccccaattccattattggacgttcaataataatt
cacgccggagaagatgaccttacttcgcaacccaccggagctgcaggagctcgtgtagca
tgtggcgttattggtgttgctaaataa

DBGET integrated database retrieval system