KEGG   Salinivirga cyanobacteriivorans: L21SP5_01693Help
Entry
L21SP5_01693      CDS       T04172                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
blq  Salinivirga cyanobacteriivorans
Pathway
blq00473  D-Alanine metabolism
blq00550  Peptidoglycan biosynthesis
blq01100  Metabolic pathways
blq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    L21SP5_01693 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    L21SP5_01693 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    L21SP5_01693 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blq01011]
    L21SP5_01693 (ddlB)
Enzymes [BR:blq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     L21SP5_01693 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:blq01011]
 Precursor biosynthesis
  Amino acid ligase
   L21SP5_01693 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 Peptidase_M20 GARS_A Ubiquitin_3 Dala_Dala_lig_N
Motif
Other DBs
NCBI-ProteinID: ALO15335
UniProt: A0A0S2HZ17
LinkDB All DBs
Position
2018918..2021065
Genome map
AA seq 715 aa AA seqDB search
MKVAIIYNKDIQGVINTFGMQSKEFYNEQTVKKVAQSLERAGHNVVILDGNKKIIDRLES
FMPRVREGEQMGMVFNMAYGIQGESRYTHIPSMLEMLGLPYVGSSPSGHALALDKVLTKV
IWKNHNLPTPEFWVFNSHDDDLTDVKYPVIVKPKMESVSFGLQVVWNEKKLREAIQFIVS
EFSQQALVEQFIRGREFAVGILGNGQAETFPVLEIDLGGNPDAIQTVTDKQKKPRQKICP
ANIAKDLTINMQQLSLDAFHALNLRDFSRVDIRLDDQNNIYLLEINSMASLGENGSYPTA
ARAAGYKFDGLVNKILDVAAVRYFSNTIMLQLPGEEQKGKLPLQARMRTFLKTRQDQTEL
LLKKLVDTNCHVRNVKGVNHCSQIISNELSSLGFSHEVYTQLEVGNILYCSNAVNQPVDY
LILLPIDNTIKLSNHENYSENEQYLEGTGIWESKGGAVILISALQVLRFTRNLKKIKIGV
LLTTDSSLDGRYSRNIIRRKADAASRIIAMSGSSKNCGLVLSRSGSASYRMESRLVNKVS
PAHVSSMAMNFNKTIAAITDISKNDPENVIAPYEIDFRSNIFKINAHGSAGLSVRFNSNE
TLGTIEQKIKKIISLQKRNSAYQTQFEGGQRRPAMIATKESLAFYEQIKAIADKIDVNIT
KEHRWSSSDICHIPAHKPKIDAMGPIGEFLHNNNERIVRHSLNERALLMAMVLKK
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagccattatttacaataaagacatccagggggtaatcaatacttttgggatg
caaagtaaggagttctacaatgaacaaaccgtaaaaaaggtagctcaaagtcttgagcgg
gccggccataacgtggtaatacttgatggtaacaaaaaaatcattgaccggctcgagagc
tttatgccccgtgtacgagaaggggagcaaatgggaatggtctttaacatggcttacggc
attcagggtgaaagccgttacacgcacattccttcaatgcttgaaatgttgggcctccca
tatgtaggctcatcaccatcgggccatgccctggcacttgataaagtactgacaaaggta
atttggaagaaccacaatttacctacccctgagttctgggtttttaacagccacgatgat
gatctgactgacgtaaaatatccggtaattgtaaaaccaaaaatggagagcgtgtctttc
gggctacaagtagtctggaacgaaaaaaagttacgggaagctatacaatttatcgtatca
gaatttagtcaacaggcactggtggagcaatttatcagaggcagagagtttgctgtaggt
attttaggtaatgggcaggctgaaacatttccagtgttagaaattgatttaggaggcaac
ccggatgctatacaaacagtaaccgataaacaaaaaaaacccagacagaaaatttgtccg
gccaacattgctaaggatttaacaattaatatgcaacagctcagccttgatgccttccat
gcattgaacctgcgtgatttttcaagggtcgacattcgtcttgacgaccaaaacaacatc
tatttgctcgaaatcaattccatggcaagtctgggagaaaatggatcttaccccacagct
gcaagagctgccggatataaatttgacggactggtcaataaaattctggatgtagccgct
gtaagatatttttccaataccatcatgctccagctgcccggagaagaacaaaaagggaaa
ctacccctacaggctcgaatgcgaacttttctaaaaacacggcaagaccaaactgaatta
ttactaaaaaaactggtagatacaaattgccatgtgcgcaatgtaaaaggggttaatcat
tgcagccaaataataagcaatgagctaagcagcctaggttttagccacgaagtttataca
caactcgaagtaggcaacatactttattgttctaatgctgtaaaccaacctgtagattac
cttattttattaccaatagacaacaccattaaattatccaatcacgaaaactatagtgaa
aatgaacaatatcttgaaggaacaggtatatgggaaagtaaaggtggtgcagtcatttta
atttccgctctacaggtattacgttttaccagaaatctaaaaaaaatcaaaattggggtt
ttattgaccacagactcttctctggatggtcgttactccagaaatataatcaggcgaaaa
gcggatgcagcttcaaggataatagccatgagcggatcttcaaaaaattgcgggcttgta
ttgtcaaggtccggctcagcatcttaccgcatggaatcaagacttgtgaataaagtatcg
cctgcacatgtatcttcaatggccatgaattttaataaaacaattgctgccattacagat
atttccaagaatgatcctgaaaatgtcattgcaccttacgaaattgatttcaggagtaat
attttcaaaattaatgctcacggctcagccgggttaagtgtgcgcttcaattcgaatgaa
acactaggtactatagaacaaaaaattaaaaaaataattagtttacaaaaacgcaacagc
gcgtaccaaacccaatttgagggcggacagcgcagaccagccatgattgccaccaaagaa
agtctggcattttatgaacaaataaaagccatagcagataaaattgatgttaatattacc
aaggaacatcgctggagctcgtcagacatttgccacataccagcacacaaacctaaaata
gatgctatgggacctataggggaattcctacataataacaacgagcgcattgttagacac
agccttaatgagcgggctctacttatggcaatggtgttaaaaaaatag

DBGET integrated database retrieval system