KEGG   Salinivirga cyanobacteriivorans: L21SP5_02639Help
Entry
L21SP5_02639      CDS       T04172                                 

Gene name
alr_3
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
blq  Salinivirga cyanobacteriivorans
Pathway
blq00473  D-Alanine metabolism
blq01100  Metabolic pathways
blq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    L21SP5_02639 (alr_3)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    L21SP5_02639 (alr_3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blq01011]
    L21SP5_02639 (alr_3)
Enzymes [BR:blq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     L21SP5_02639 (alr_3)
Peptidoglycan biosynthesis and degradation proteins [BR:blq01011]
 Precursor biosynthesis
  Racemase
   L21SP5_02639 (alr_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ALO16262
UniProt: A0A0S2I1Q1
LinkDB All DBs
Position
3178834..3181266
Genome map
AA seq 810 aa AA seqDB search
MLNLKKVAEISQGECLGSCSGQVKYLLTDSRKLTLPEQVLFFAIPGKYHNGHAYIPALIK
KGVSQFVVSELPEKQWLEKADFVKVHDVISALQSVAAWWRSYFSLPVIGVTGSNGKTIVK
EWIAQSLGDTVRMTRTPGSYNSQIGVPLSVWMLSDGAQFGLFEAGISFPGEMEKLQTIIK
PTIGLFTNLGDAHQENFSSFTQKLEEKLKLFKNADVVIYRNEGDWVSEKIEAYCTERKKF
TWSFKEEADVEAQLDDGVLKVQYANQKLSLSIPFSDKASVENLMHTITLLCYLGYDSDFI
YRAVAKIRAVPMRLEQKSGRAHNTIINDSYNSDLGSLSNALDFLEQQKQHPRKVLVLSDI
FQSGYAKENLYKEVSVLVNAHKPDLMLGVGKDLMPYRELFHLESHFFKSTTELIAALGDF
DLTDTTILLKGSRAFHFEEVDKILEEKTHRTVLEVNLNALTHNLNYFKSLLKPDADIIVM
VKAFSYGSGSHEIANILQYHRVAYLAVAFADEGVDLRARGIDLPIMVMNPHISDFDSLVR
YRLEPVVFDYGMLSSLGKYLVQQGERRFSVHLKLNTGMNRSGFNPSDIDNLIDELKKQPA
MYVQTAFSHLASSDEPMHDKFTHDQARVYNTMCKKLELAFDRNIKKHLLNSAGIERFREY
QFDYVRLGIGLYGISVADADLKQVGRLRTSIAQIRDVMPGETVGYGRSGEVENPKKIATI
PIGYADGFRRILSNGRGKVFISGNLYPVIGNVCMDMTMIDITGANVEVGDEVVIFGPELP
IEEVAGWLETIPYEVLTSVAARVKRIYVKD
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatctaaagaaagtagcagaaatatcgcaaggtgaatgcctggggtcgtgtagc
ggtcaggtaaaatatttgctaaccgacagcagaaagctcaccctgccagaacaggtattg
ttttttgctatccccggcaagtatcacaatggccatgcatacatccctgcattaattaaa
aaaggtgtcagccaatttgtggtttcagaattgcccgaaaagcaatggcttgaaaaggca
gatttcgtcaaagtccatgatgtgattagtgccttgcagtcggttgctgcatggtggagg
tcgtattttagtttaccggttattggtgtaaccggaagcaacggtaaaacaattgttaaa
gagtggattgcccagagcctgggagacaccgtaaggatgaccaggacccctggtagctat
aattcacaaattggtgttccgctctctgtttggatgctcagcgatggtgcccagtttggc
ctttttgaagcgggtatttcttttccgggcgaaatggaaaaattacagactattataaag
cctacaattggtctgtttaccaatcttggtgatgctcatcaggaaaacttcagttcattt
actcaaaaacttgaggaaaaattaaagctattcaaaaatgctgatgtggtaatttatcgt
aatgagggcgattgggtaagtgagaaaattgaagcttattgcactgagaggaagaagttt
acatggtcttttaaagaagaggccgatgtagaggcgcaactcgatgatggtgtgttaaaa
gttcaatatgcaaatcaaaaactaagcctttcaataccatttagcgataaagcatcagta
gagaacctaatgcacaccattacactattgtgctatttaggatatgattcagattttatt
tacagggcagtagccaaaatcagagctgttcctatgcgtttggagcaaaaatcgggaagg
gcacataatactattatcaacgatagttataactccgatttagggtcgctttctaatgca
cttgattttcttgaacagcaaaaacagcatccacgaaaggttttagtgctatcagatatt
tttcagagtgggtatgcaaaagagaacctgtacaaagaagtatcagtgctagttaatgct
cataagcctgatttaatgctgggagtcgggaaagacctgatgccatacagagagcttttc
catctcgagagccatttttttaaatcgaccactgaattaattgcagccctgggcgatttt
gatttaacagatactactatactgcttaaaggcagccgtgccttccattttgaagaggtt
gataaaattctggaagaaaaaacacaccgtacagtactggaggtaaacctcaatgcctta
acacacaatttaaactactttaagtcattgctaaagcccgatgcagacataattgtgatg
gttaaagcattctcgtatggtagtggttcgcacgaaattgctaatattttacagtaccac
cgggtagcttacctggcagttgcttttgccgatgagggtgtggatttacgtgcacgtggc
atcgatttgcctattatggtcatgaatccgcacatttctgattttgatagcctggtacga
taccggcttgaacctgtggttttcgattatggaatgctttcgagcctgggtaaatacctg
gtgcagcaaggagaaagaaggttttcagtgcaccttaaattaaatacaggcatgaacagg
tccgggtttaatccttctgatatagataacctgatagatgagctgaaaaaacagccggcc
atgtatgtgcaaactgctttttctcatttagcttcaagcgatgagccaatgcatgacaaa
tttacccacgaccaggccagggtttataatacaatgtgcaagaaactggaattagctttt
gatagaaacattaaaaaacaccttttaaacagtgccgggattgagcgttttcgcgaatac
cagtttgattatgtgcgccttggaattggcttatatggaataagtgtagcagatgctgac
ctaaagcaggttggcaggctccggacaagtattgctcaaatcagagatgtaatgccgggt
gaaactgttggttatggccgcagtggagaagtcgaaaatccgaaaaaaattgctacaata
cccatcggttacgccgacggattcaggcgaatacttagtaatggcagaggtaaagttttt
ataagcggtaatttatatccagtgattggtaatgtatgtatggatatgactatgatagac
attacgggtgctaatgtggaagttggagatgaggttgtaatatttggaccagaattacca
attgaggaagttgcaggatggttagaaaccataccttatgaagtgcttaccagtgtggct
gcaagggttaaaagaatttatgtaaaagattaa

DBGET integrated database retrieval system