KEGG   Salinivirga cyanobacteriivorans: L21SP5_03295Help
Entry
L21SP5_03295      CDS       T04172                                 

Gene name
sodA_2
Definition
(GenBank) Superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
blq  Salinivirga cyanobacteriivorans
Brite
Enzymes [BR:blq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     L21SP5_03295 (sodA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALO16908
UniProt: A0A0S2I4J1
LinkDB All DBs
Position
complement(3997627..3998226)
Genome map
AA seq 199 aa AA seqDB search
MSFKLTNLPYDFNALEPYIDAQTMEIHHDKHHGGYTKKLNAALEKEGVNNNNIEDILSNV
SKYSVGVRNNGGGYYNHNLFWEIMSPNGGGEPTDEIGKAIKETFGSFDAFKDEFAQAAAG
RFGSGWAWLVKDNGKLKIGSTPNQDNPLMDISEFKGQPILGLDVWEHAYYLKYQNRRPEY
IDAFFNVINWDKVNELYKA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaattaacgaatttaccatacgattttaatgcactggaaccttacatcgat
gcccaaaccatggaaattcaccatgataaacaccatggcggttataccaagaaactgaat
gccgcattggagaaagaaggtgtaaacaacaataatattgaagacatactcagtaatgtc
tcaaaatactctgtaggagtaagaaataatggtggtggatattataatcacaacctgttt
tgggaaattatgagccccaacggaggtggcgaacctactgacgaaataggtaaagcaatt
aaagaaacatttggctcgtttgatgcctttaaagatgagtttgctcaggctgcagccgga
cgatttggttcaggttgggcatggttagtaaaagacaacggcaagctcaaaataggtagc
accccaaaccaggataatccattaatggatatctcagagtttaaaggacaaccaatacta
ggtttagacgtgtgggaacacgcgtattatctgaaatatcagaacagaagaccagaatac
attgatgcatttttcaacgtaattaactgggataaagtcaacgagttatataaagcataa

DBGET integrated database retrieval system