KEGG   Brevibacillus laterosporus: BRLA_c004250Help
Entry
BRLA_c004250      CDS       T03762                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
blr  Brevibacillus laterosporus
Pathway
blr00473  D-Alanine metabolism
blr01100  Metabolic pathways
blr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BRLA_c004250
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BRLA_c004250
Enzymes [BR:blr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BRLA_c004250
Peptidoglycan biosynthesis and degradation proteins [BR:blr01011]
 Precursor biosynthesis
  Racemase
   BRLA_c004250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIG24806
UniProt: A0A075R045
LinkDB All DBs
Position
408569..409774
Genome map
AA seq 401 aa AA seqDB search
MKPYARDTWIEVDLDAIAANVSALRQHIPAHSEIMAVVKADGYGHGSEYTAREALAHGAT
RLAVAALDEALVLRRAGITAPILVLGYTPVDAMQTAVEENIQLTVYHLQWLQDAARLLIG
SSKKLEIHVKVDTGMGRIGVSDEKELLELIHTITTNDSMRWVGIFTHFACADEEDTTHVK
GQHTLFQERLKAVEQAGYKLPLIHCNNTAAAIVFPEWSYDLIRLGIGLYGLYPSDFIKQQ
HVLDLKPALSLKTRISHVKNMPPHSTISYGATYTTTDQEQIATVPIGYGDGFPRLLSNRG
VALCHGKRVPIVGRVCMDQTILHIHSGDAQVGDEVVLYGKQGNEEITLDEIAECLGTINY
EVTCMLNYRIPRVYLRNGKIVGICHGIANKFLEEYRKMAGI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagccatatgcccgcgatacatggatagaagttgatctggatgcgattgcggctaat
gtctctgccctgcgccaacatatccctgcccactcagaaataatggcagtagttaaagcg
gatggatatggtcatggttcagaatatacggccagagaagcacttgcgcatggagctacc
agactggcggtagctgctttagacgaggcgcttgtgctgcgacgagcaggtattacagca
ccgatccttgttttaggttatacccccgtagatgctatgcaaaccgctgtagaagagaat
attcaattgaccgtttatcatcttcagtggctgcaagatgctgcccgtcttttgataggc
agttctaaaaagttggagattcatgtcaaagttgatacaggtatgggacgcatcggggta
agtgatgaaaaagaattactggagcttatccatacgataactacaaatgattccatgcgt
tgggttggaatattcacgcactttgcttgcgcagatgaggaagacactacacatgtaaaa
ggacagcacaccttatttcaggaacgtctgaaagctgttgagcaagcaggctataagctt
cctctcattcattgcaataatacggctgcagctattgtttttccagaatggagttatgat
ttgattcgattgggcataggcttatacggattgtatccttccgacttcataaaacaacag
catgtacttgatctaaaaccagctctcagcttaaaaacccgaatttcccatgtgaaaaat
atgcccccgcattccacaatcagctatggagccacctatacaaccaccgatcaagaacag
atagccactgtgccaatcggatatggtgatggctttccccgtttattgtctaatcgaggt
gtcgccttatgtcatggcaaacgagtgcctattgtaggcagagtgtgtatggaccaaacc
attcttcatattcactcaggagatgcccaggtgggggacgaagtggttttgtacggaaaa
caagggaatgaagaaattacgctcgacgagatagccgagtgtttgggaacaatcaattat
gaagtaacatgtatgctcaattatcgcattcctcgcgtttacttacgaaatgggaaaatt
gtcggtatctgtcatggaattgccaataaattcttggaagaatatcgaaaaatggcagga
atttag

DBGET integrated database retrieval system