KEGG   Brevibacillus laterosporus: BRLA_c005240Help
Entry
BRLA_c005240      CDS       T03762                                 

Definition
(GenBank) DegV domain-containing protein
Organism
blr  Brevibacillus laterosporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegV Dak1_2
Motif
Other DBs
NCBI-ProteinID: AIG24882
UniProt: A0A075QWV1
LinkDB All DBs
Position
501778..502623
Genome map
AA seq 281 aa AA seqDB search
MSEIAIITDSTSYIPKELQDELQITVVPLQVVYGNKAYREEVELTEADFYSKLKTNDQLP
TTSQPPVGEFVEAYMKLSKNHKRAIAIHMSSGISGTYQGAVTATTMVDDFPIDVIDSEIT
TYAMGAVVVEAARMAQAGKSREEILERIEYIRTQMKTYFLVEDLDFLYRGGRLSAAQLML
GNMLKIKPILTFENKKIVPYQKVRTRAKAKAGIMELFEAEAKAGKPIQLSIIQAQVQEEA
EEWKAYIEATYPHVTVTISHFGPVIATHVGPGAIGLTWYNK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagaaattgcaattataacagatagcaccagttatattccaaaagagctccaagat
gaattacaaattacagtagtgcctctgcaagtggtttatggaaacaaagcgtatcgcgaa
gaagtagaattaacggaggctgatttttactccaagctaaaaacgaatgatcagttgccg
acgacatctcagccacctgtaggcgagtttgtggaagcctatatgaaattatctaaaaat
cataagcgagcaattgctatccatatgtctagtggtattagtggtacctatcagggagcg
gtaacagcgaccacgatggttgatgattttcctattgatgtcattgattctgagattact
acatatgcaatgggtgctgttgtcgtggaagcagctagaatggcacaggctggtaaatca
cgagaagagattcttgagcgtatcgaatacatacgtacgcaaatgaaaacgtacttttta
gttgaggatttagatttcttgtaccgcggaggtcgcttgtcagcggctcaattaatgctg
ggcaatatgcttaaaatcaaaccgattctaacgtttgagaataaaaagattgttccctat
caaaaagtcagaacacgtgccaaagccaaggccgggattatggaattatttgaggcagag
gccaaagcaggcaaacctatacagctttccatcatccaagcgcaggttcaagaagaggca
gaggaatggaaggcttacattgaagcgacctatccacatgtaacggtgacaatcagtcat
tttggaccagttattgccactcatgtgggtcctggagccattggattaacttggtataat
aaataa

DBGET integrated database retrieval system