KEGG   Brevibacillus laterosporus: BRLA_c007210Help
Entry
BRLA_c007210      CDS       T03762                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
blr  Brevibacillus laterosporus
Brite
Enzymes [BR:blr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BRLA_c007210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIG25079
UniProt: A0A075QZQ2
LinkDB All DBs
Position
703000..703608
Genome map
AA seq 202 aa AA seqDB search
MAHQLPALPYANNALEPHFDALTMEIHHDRHHATYVNNLNAALEGNADLQGKSVEELISN
LDALPEAIRTAVRNNGGGHANHSLFWEILSPNGGGNPTGAIADAINAAFGSYDNFKAEFT
KAATGRFGSGWAWLIVDGDKVAITSTPNQDSPIMEGKTPVLGLDVWEHAYYLNYQNKRPD
YINAFWNLINWDEVNKRFAAAR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcaactacctgcactaccatatgcgaacaatgcattggaaccacattttgac
gcattaacaatggaaatccaccatgatcgtcatcatgctacttacgttaacaatttaaat
gctgccctagaaggaaatgctgatcttcaaggtaaaagcgtagaggaattaatttctaat
ctggatgcacttccagaagctattcgcacagccgtacgcaacaatggtggcggacatgcg
aaccatagcttattctgggaaatcttaagcccaaatggcggtggaaacccaacaggtgct
attgctgatgcaatcaatgctgcattcggtagctacgataactttaaagctgagtttaca
aaagcagctacaggccgtttcggttctggttgggcttggctaattgtagacggtgataaa
gtagcaatcacttccacccctaaccaagatagcccaattatggaagggaaaactcctgtt
cttggcttagacgtttgggagcatgcttattacctgaactaccaaaacaaacgcccagac
tacatcaatgctttctggaacttgattaactgggatgaagtaaacaaacgtttcgcagca
gctcgctaa

DBGET integrated database retrieval system