KEGG   Brevibacillus laterosporus: BRLA_c009080Help
Entry
BRLA_c009080      CDS       T03762                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
blr  Brevibacillus laterosporus
Pathway
blr00010  Glycolysis / Gluconeogenesis
blr00030  Pentose phosphate pathway
blr00051  Fructose and mannose metabolism
blr00052  Galactose metabolism
blr00680  Methane metabolism
blr01100  Metabolic pathways
blr01110  Biosynthesis of secondary metabolites
blr01120  Microbial metabolism in diverse environments
blr01130  Biosynthesis of antibiotics
blr01200  Carbon metabolism
blr01230  Biosynthesis of amino acids
blr03018  RNA degradation
Module
blr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:blr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRLA_c009080
   00030 Pentose phosphate pathway
    BRLA_c009080
   00051 Fructose and mannose metabolism
    BRLA_c009080
   00052 Galactose metabolism
    BRLA_c009080
  09102 Energy metabolism
   00680 Methane metabolism
    BRLA_c009080
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BRLA_c009080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:blr01009]
    BRLA_c009080
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:blr03019]
    BRLA_c009080
Enzymes [BR:blr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BRLA_c009080
Protein phosphatases and associated proteins [BR:blr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BRLA_c009080
Messenger RNA biogenesis [BR:blr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BRLA_c009080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AIG25249
UniProt: A0A075R076
LinkDB All DBs
Position
890422..891381
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAAVRRAIYKGVQIFGVYNGYNGLISGNIKELTLGSVGDI
IHRGGTMLFTARSDEFRTEEGRAKAVEQLKKHGIEGLIVIGGDGSFRGAQKLTQLGFPTI
GVPGTIDNDIPCTDFTIGFDTALNTVVECIDKIRDTATSHERTYIVEVMGRDAGDLALWA
GLAAGAESIIIPEADTDMKDILERLRSGHRRGKKHSIIIVAEGVGQASQFADVIKAETGW
ETRVTVLGHIQRGGSPTAFDRMLASRLGAAAVDLLLEGKADRMVGIKNNTIVDVDIDEAL
DQKHQLDLSIYQLARSLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgctgttttaactagtggtggcgatgctccaggtatgaacgcggctgtt
cgtgctgcggtacgtcgagctatttacaagggcgttcaaatttttggagtttacaatgga
tataatggtcttattagcggtaacatcaaggaattaacacttggttctgtaggtgacatt
attcatcgtggtggtacaatgctttttacagctcgtagcgacgagttcagaacggaagaa
ggacgagcaaaagcggttgagcaattaaagaaacacggaattgaaggtctaattgttatc
ggcggtgacggttcgttccgcggtgcgcaaaaactaactcagcttggcttcccaacaatt
ggtgttccgggtactattgataatgacattccatgcactgactttacaattggctttgac
acagcattaaacactgtagtagaatgcattgacaaaatccgcgatacagctacttcacat
gagcgtacgtacattgttgaggttatggggcgcgatgcaggtgacttggctctgtgggct
ggtttagctgctggagcagaatccatcatcatccctgaagcagatacggatatgaaggat
attctggagcgactacgttcaggacatcgccgcggtaaaaagcattccatcattattgtg
gcagaaggggtaggccaagcttctcagttcgcagatgtcatcaaggcagaaacaggctgg
gagactcgtgtcactgttctaggacatattcaacgtggtggttctccaactgctttcgac
cgtatgctagcaagtcgtttaggtgcagctgctgtagatttgctgcttgagggcaaagcg
gatcgcatggttggaattaagaacaataccatcgtagacgttgatattgatgaagcgctt
gatcaaaaacatcaactagacttgtcaatttaccaattagcgcgttctctatccatttaa

DBGET integrated database retrieval system