KEGG   Brevibacillus laterosporus: BRLA_c009160Help
Entry
BRLA_c009160      CDS       T03762                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
blr  Brevibacillus laterosporus
Pathway
blr00020  Citrate cycle (TCA cycle)
blr00480  Glutathione metabolism
blr01100  Metabolic pathways
blr01110  Biosynthesis of secondary metabolites
blr01120  Microbial metabolism in diverse environments
blr01130  Biosynthesis of antibiotics
blr01200  Carbon metabolism
blr01210  2-Oxocarboxylic acid metabolism
blr01230  Biosynthesis of amino acids
Module
blr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
blr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:blr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BRLA_c009160
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BRLA_c009160
Enzymes [BR:blr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BRLA_c009160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIG25257
UniProt: A0A075QY29
LinkDB All DBs
Position
898462..899745
Genome map
AA seq 427 aa AA seqDB search
MFKNLSAPTHGEKITVDNGKMVVPNNPIIPFIEGDGTGPDIWNASVRVLDAVVEKAYKGE
KKIAWFEVFAGEKAFNQYGEWLPEDTLTAIREYLIAIKGPLTTPVGGGIRSINVALRQEL
DLYACVRPVQYFDGVPSPVKHPELTDMVIFRENTEDIYAGVEWAEGSDEVKKVIQFLQSE
MGVKKIRFPESSGIGIKPVSKDGTERLVRAAIEYALENNRKSLTLVHKGNIMKFTEGAFK
NWGYEVAEAEYGDKVFTWAQYDRLKAEGKDADQAQKEAEAAGKLIVKDVIADAFLQQILT
RPAEYDVVATLNLNGDYISDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYAGLD
KVNPSSVILSGEMMLRHLGWNEAADLLIAAMEKTISSKEVTYDFARLMDGAKELKTSEFA
DALIKNL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaaatctttctgcaccaacacatggagaaaaaatcaccgtagataatggcaaa
atggttgtacctaacaatccaatcattccttttattgaaggggatggaactggacctgat
atttggaatgcatctgttcgcgttttagatgcagtcgtagaaaaagcatataaaggcgag
aaaaaaatcgcgtggtttgaagtatttgctggtgaaaaagcatttaatcaatatggtgag
tggctgcctgaagatacattaacagcaattcgtgaatatctgatcgcaattaaaggacct
ttaacaactccagttggaggtggaattcgatctatcaacgtggcattgcgtcaagagctt
gatctgtatgcttgcgtacgccctgttcaatacttcgatggagtaccatctcctgttaaa
cacccagaacttactgacatggtgatcttccgtgaaaatactgaagacatctatgctggt
gtcgaatgggctgaggggtccgatgaagttaaaaaagttattcaattcttacaaagcgaa
atgggcgtaaagaaaattcgcttcccagaatcttctggtatcggtattaagcctgtttcc
aaagatggtacagaacgtttagttcgcgctgcaattgagtatgctttagaaaacaaccgt
aaatctctaacccttgttcacaaaggtaatattatgaaatttaccgaaggcgcattcaaa
aactggggttatgaagttgctgaagcggaatatggtgataaagtatttacatgggcacag
tacgaccgtttaaaagcggaaggaaaagatgccgatcaagcccaaaaagaagcagaagca
gcaggcaagctaatcgtaaaagatgtgattgcagacgcttttttgcaacaaatcttgact
cgtccagcagaatatgatgtagtagctacattgaatctaaatggtgattacatttccgac
gcattggctgcacaagttggaggtattggtatcgcccctggtgccaacatcaactatttg
acaggtcatgctatttttgaagcaacccatggtacagctccaaaatatgctggtcttgat
aaagtaaacccatcttctgtaatcctgtctggtgaaatgatgcttcgtcatttaggttgg
aatgaagcagctgatctgttgatagcagcaatggaaaaaacaatttcatctaaagaagtt
acgtatgattttgcccgtctgatggatggtgcaaaagaactgaaaacatctgaatttgca
gatgccttaatcaaaaatctttag

DBGET integrated database retrieval system