KEGG   Brevibacillus laterosporus: BRLA_c014060Help
Entry
BRLA_c014060      CDS       T03762                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
blr  Brevibacillus laterosporus
Pathway
blr00473  D-Alanine metabolism
blr00550  Peptidoglycan biosynthesis
blr01100  Metabolic pathways
blr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BRLA_c014060
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BRLA_c014060
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BRLA_c014060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blr01011]
    BRLA_c014060
Enzymes [BR:blr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BRLA_c014060
Peptidoglycan biosynthesis and degradation proteins [BR:blr01011]
 Precursor biosynthesis
  Amino acid ligase
   BRLA_c014060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIG25745
UniProt: A0A075R876
LinkDB All DBs
Position
1488062..1489210
Genome map
AA seq 382 aa AA seqDB search
MGNKIRLGIIYGGKTSEHEVSLLTALSIMKAVDKNKYEVQPIYVQMDGTWLKGGPIADQV
LESVNVLRLDGGVSSGSNDHDQEKQGQITLAGNQSLMGKPANVMSIHQEVDVIFPVIHGP
NGEDGTVQGLLELADIPYVGTGVMASAVGMDKLMMKNVFAQAGLDQVQYMGFLRSQIERE
VDSVMNQIEQKLGYPCFVKPANMGSSVGITKAKDRDDLRGALELACKFDRRIIVEEFIKA
REVEIGVLGNEELRTSVIGEVIAAKEFYDYEAKYKGGGTDLKIPADLPQQVADRIAEMAK
TAFQALDGSGLSRVDFFYDEENDRVVINEVNTMPGFTPFSMYPMLFAEAGIPYAELIDQL
VQLGLERYEEKQRNIVAAEELE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaaaatccgattgggcattatttacggaggaaagacatctgagcatgaggta
tcgctcttaacggccctttctattatgaaggcagtagataaaaataaatatgaagtacaa
ccgatctatgtacaaatggatgggacttggttaaaaggtggacctatcgcagatcaagtc
cttgaaagtgtgaatgtgctacgcttagatgggggagtatcttctggtagtaatgatcat
gatcaagaaaagcaagggcaaataactcttgcgggtaaccaatcactgatgggtaagcca
gctaatgtgatgtccattcatcaggaagtagatgttatttttccagtgattcatggacca
aatggtgaggatggtactgtacagggtttattagaattagcagatattccttatgtgggt
acaggagttatggcatctgcagtgggaatggacaaattgatgatgaaaaatgtttttgct
caagcaggtcttgatcaagttcaatacatgggcttcttacgttctcaaatcgagcgtgaa
gtagacagcgttatgaaccagattgaacaaaagctaggctatccttgttttgtaaagcca
gccaatatgggttctagtgttggaattactaaagctaaagaccgagacgatttgcgtgga
gctttggaacttgcttgtaaattcgatcgtcgtattattgttgaagagttcattaaagcc
cgtgaagtagaaattggtgtattagggaatgaagaattacgcacctccgtcattggggaa
gttattgcagccaaagaattttatgattatgaagcgaaatataaaggtggaggtactgat
ctcaaaatcccagctgatctaccacagcaagtagccgatcgtattgctgagatggcaaaa
acggcatttcaggcattggatggctccggtttatcacgtgttgatttcttctatgatgag
gagaatgaccgtgtagtaattaatgaggttaatacgatgccaggctttaccccatttagc
atgtatccaatgttatttgcagaagcaggcattccgtatgctgaactaatcgatcaactt
gttcaactagggctagagcgttatgaagaaaaacaaaggaatattgtagcagctgaagag
ctagaatag

DBGET integrated database retrieval system