KEGG   Brevibacillus laterosporus: BRLA_c033610Help
Entry
BRLA_c033610      CDS       T03762                                 

Definition
(GenBank) putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
blr  Brevibacillus laterosporus
Pathway
blr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:blr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BRLA_c033610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:blr03400]
    BRLA_c033610
Enzymes [BR:blr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BRLA_c033610
DNA repair and recombination proteins [BR:blr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BRLA_c033610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme TbpB_C
Motif
Other DBs
NCBI-ProteinID: AIG27673
UniProt: A0A075R8R9
LinkDB All DBs
Position
3717514..3718452
Genome map
AA seq 312 aa AA seqDB search
MNPIIPFEPTICESIPQGSEWIAQIKWDGVRILTYFDGQQVQLFNRRGNERTWHYPEITN
IATYSSATSLILDGEVISLGSTGKPSFHEVMRRDGIRRLEKVSHIKSQVPITYMIFDILF
VNGDWVNHLPLRDRMELLQQWIKPSEHIQLVTSHPDGHALYKVVQEHQLEGIVLKDLTSS
YLINGKDKRWQKKKYYRDLIAVIGGVTFRDQVVNSLLLGLYTPDGHLHYIGHAGTGKLTN
ADWLALTQVIKPLLQKEMPFINRPDRYKDASWLSPELTVKVHFAEWTSGLTLRQPSIQAF
VDVPAQSCRFDV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaatcatcccatttgaaccaaccatttgtgaaagtattcctcaaggctctgaa
tggatagctcagattaaatgggacggtgttcgcatcttaacctattttgacggtcaacag
gttcagctatttaacagaagaggcaacgaaagaacctggcactaccctgaaatcacaaat
atagctacgtatagttcagccacttcccttattttggacggtgaagtaatttcccttggt
tctacaggaaaaccatcctttcatgaagtaatgcgtagagatggaattcgccgtcttgaa
aaggtatctcatataaaatcccaggttcccattacttatatgatctttgatatcctattt
gttaatggggactgggtcaatcatcttcccctacgcgatcgaatggaactgctacagcag
tggatcaagccttctgagcatattcagctggtaaccagtcatcccgacggacatgcacta
tataaggttgtacaagaacatcaattagagggcattgttctaaaagatctaacaagtagc
taccttatcaatggaaaggataagcgttggcaaaagaaaaaatactaccgtgatctgatt
gctgttataggcggtgttacgtttcgcgatcaggtggttaactcgcttctattaggactc
tacacacccgatggtcatttacactatattggtcatgctggtacaggaaaactgacaaat
gcagattggttagcattaacacaggttatcaagcctctccttcaaaaggagatgcccttc
ataaatcgaccagatcggtataaggatgccagttggctttcacctgaactaacggtaaaa
gtgcattttgctgagtggacaagcggtttaacattgcgacaaccaagtattcaagccttt
gtcgatgtaccagctcagtcatgtcgatttgatgtgtaa

DBGET integrated database retrieval system