KEGG   Bifidobacterium animalis subsp. lactis Bi-07: W91_0082Help
Entry
W91_0082          CDS       T02080                                 

Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bls  Bifidobacterium animalis subsp. lactis Bi-07
Brite
KEGG Orthology (KO) [BR:bls00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bls01001]
    W91_0082
Enzymes [BR:bls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     W91_0082
Protein kinases [BR:bls01001]
 Serine/threonine kinases: Other
  Bacterial family
   W91_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 Haspin_kinase DUF4307
Motif
Other DBs
NCBI-ProteinID: AFJ17402
LinkDB All DBs
Position
complement(93919..96051)
Genome map
AA seq 710 aa AA seqDB search
MSSMPTTLDNGRYQLGQLVGRGGMAEVHIALDTRLGRTVAVKIMRADLAHDEIFLTRFRR
EAHSVAQMNNPNIVNIYDSGEEVVTLDNGQTEHLPYLIMEYVQGQTLRDIIKANGALSVS
DTEHVMIGVLNALEYSHRMGIIHRDIKPGNIMISEQGIVKVMDFGIARALDDSATTMTKS
QGVVGTAQYLSPEQARGENVDMRSDLYSAGCVLYEMLTGRPPFTGDSAVAIAYQHVSEVA
AKPSSIVPGLNPMWDQIVAKAMAKDRQNRYATATEFKNDILTYMNGGLPSAAAFNPLQDL
STINATKTQTMAAANDYPANEGSTRVYNPVTGQFQTVPQDPNAAAGDTDTMVKSRSQKRL
EAARKRKRNTIITVVVLVVLALAAAGGWYAWAHMQPPKKEYVTVPTFSATTTEERAKAQL
AELGLQASIKQDTDSREPAGTFTKQAPAGGRSVEKGSTVTVWFSAGPKSVPVPNVTGQSQ
ADARAALEAAGFEVNSSVQTEDSATIERDHVTRTDPAAGTSAEQGTTVSLWVSSGMTKVP
SGLIGKSKDEAVDELQKNGFAVEINTENSSQPENTVTRIEPNEGTSVERGASVTIWVSNG
KVAVPNVVGRTLGEAKAALTDSALNLKWKVAANSKDNDDAVVTASNPSAGSQVNPGTEVT
LTTEPKESPSPSPSPSNSNGSSGSNGNSGNGDSNSGSQSSQNQQNSDNKH
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcatgcctaccacgctcgataacggccgctaccagcttggccagctcgttggc
cgcggtggcatggccgaggtgcacatcgcactcgatacacgcctgggtcgcaccgttgcc
gtcaagatcatgcgcgccgacctcgcacatgacgagatcttcctcacccgcttccgccgt
gaggcgcattccgtggcccagatgaacaacccgaacatcgtgaacatctacgattcgggc
gaagaggtggtcacgctcgacaacgggcagaccgaacacctgccatacctgatcatggag
tatgtgcaggggcagacgctgcgcgacatcatcaaggcgaacggcgcgctgagcgtctcc
gacaccgagcatgtgatgatcggcgtgctcaacgcgctcgaatattcgcaccgcatgggc
atcatccaccgcgatatcaagcccggcaacatcatgatctccgagcagggcattgtgaag
gtcatggacttcggcatcgcccgcgcgctcgacgattccgccaccacgatgaccaagtcg
cagggcgtcgtgggcaccgcgcagtatctatctcccgagcaggcgcgcggcgagaacgtc
gacatgcgctccgacctgtattcggccggctgcgtgctttacgagatgctcaccggcaga
ccgccgttcaccggcgattcggcggtggcgatcgcctaccagcatgtttcggaagtcgcg
gcgaagccgagttccattgtgcccgggctcaaccccatgtgggaccagatcgtggcgaag
gcaatggccaaggatcgccagaaccgctatgccacagccaccgagttcaagaacgacatt
ctcacctacatgaacggcggcctgccctcggcggccgcgttcaacccgctgcaggatctc
tccacgatcaacgcgaccaagacgcagacgatggcggcggcgaacgactaccccgccaac
gaggggtccacacgcgtgtacaacccggtgacgggccagttccaaacggtgccgcaggat
ccgaatgctgcggccggcgacaccgacacaatggtgaagagccggtcacagaagcgtctt
gaagcggcgcgtaagaggaaacgcaatacaatcatcaccgtggtcgtgctcgtggtgctc
gcgctggccgcagccggtggatggtatgcgtgggcgcacatgcaaccgccgaagaaggag
tacgtcaccgtgcccactttctcggccacaaccaccgaggaacgcgcgaaggcacagctc
gcggagctcggacttcaggcatcgatcaagcaggacaccgattcgcgcgagccagccggc
accttcacgaagcaggcacctgccggcggccgcagcgtggagaagggcagcaccgtcacc
gtctggttctccgccggaccgaagagcgtgccggttcccaatgtcaccggccaatcccag
gccgacgcccgagctgccctcgaagccgccggtttcgaggtgaattcgagtgtgcagacc
gaagacagcgccacaatcgaacgcgaccatgtcacacgcaccgaccccgcagccggcacc
tccgctgagcagggaaccacggtgagtctgtgggtgtcgtccggcatgacgaaggtgccg
agcgggctcatcggcaagtcgaaggacgaggccgtggacgagctccagaagaacggtttc
gccgtggagatcaacaccgagaactcgtcacagcccgagaacacggttacgcgcatcgag
ccgaacgagggcacatcggtggagcgaggcgcctccgtgaccatctgggtgtcgaacggc
aaggtagcagtgccgaacgttgtaggccgtacactcggggaagccaaggccgcactcacc
gattcggctctcaacctcaagtggaaggtggcagccaatagcaaagacaacgatgatgcc
gtagtaacagcctcgaatccgagcgcagggtctcaggtcaatccaggtaccgaggtgaca
ctcaccactgagcccaaggaaagcccaagccccagcccctcaccgagcaatagcaacggc
agcagcgggagcaacggcaactccggcaatggagacagcaacagcggctcccagtcctcg
cagaaccagcagaacagcgacaacaaacactag

DBGET integrated database retrieval system