KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0053Help
Entry
Balat_0053        CDS       T00924                                 

Definition
(GenBank) beta-galactosidase I
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
blt00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:blt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Balat_0053
Enzymes [BR:blt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Balat_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M DUF4350 Glyco_hydro_42C ABC_transp_aux
Motif
Other DBs
NCBI-ProteinID: ACS47016
LinkDB All DBs
Structure
PDB: 

Position
complement(55366..57471)
Genome map
AA seq 701 aa AA seqDB search
MARAYTDPILFGAAYYDEYIPRDLDRIDTDMEMMTRAGINVIRIGESTWSTCEPQPGHFD
WTHIDRALDAATNAGINVIVGTPTYAVPTWLVAMYPDVLATTPAGEPHYGARQIMNIVNP
AYRLYGERVIRSLISHVAQQPCVIGYQVDNETKYYDSVSHDMQVMFIKQLRHEFKNDLEA
LNEAYGLDYWSNRINAWEDFPDLTGSINESLRARFDRFRRDQVAEYLAWQASIIREYMRD
DQFITHNFDYEWRGHSYGLQPAVDHFRAARALDICGVDIYHPSEDALTGKEIAFGGDMAR
SAGGGNYLVLETQAQGQHGWLPYPGQLRLQAYSHLASGADGIMYWHWHSIHNSFETYWRG
LLSHDFESNPTYEEAGRFGREIGDPRIGDTLSHLSKRNAVAILASNESLTALSWFHIETG
FPMGGTLTYNDVLRSIYDALFELNVEVDFLPADASADQLAGYSLVIAPALYTTDQQTIDR
LARYVKNGGHLLATMRSFVADENVKVWHDKAPHHLVDIFGMTYNQFTRPMGVSLKCPDTL
ADLAGASANDFIEMLSPAPETHVLAWYDHYAWDSYAAITRHAFGSGDAQWVGTQLQADAW
RTVLAEALSNAGVHTPGMELAGTVCVRSGTNTAGDTVTYLLNYSGSPITFRAPASGTFLL
GHPTDDGEQAVTAETPVTVGDAVTLPRWGVDIIVGRQPTMN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgcatacaccgaccccattctgttcggcgcagcatactatgatgaatacatc
ccgcgcgatctggatcgcattgacaccgacatggagatgatgacccgagcgggcatcaac
gtcattcgcatcggcgaatccacgtggtccacatgcgaaccccagcccgggcatttcgac
tggacgcacatcgaccgcgcgctcgacgcggcgaccaacgccggaatcaacgtgattgtg
ggaaccccgacctatgcggtacccacatggctcgtcgccatgtatccggacgtccttgcc
accacaccggccggggaaccccactacggggcgcggcaaatcatgaacatcgtcaacccg
gcctaccgcctttacggcgagagggtgatccgatccctcatctcccacgtggcacagcag
ccttgcgtcatcggctatcaggtagacaatgagacgaaatactacgattccgtctcccac
gacatgcaggtgatgttcatcaaacaactacgccacgaattcaagaacgacctcgaggca
ttgaacgaggcgtacggcttggattactggtcgaatcggatcaatgcgtgggaggacttc
ccggatctcaccggttcgatcaacgagtcgttgcgcgcgcgattcgacaggttccgccgc
gatcaagtggcggagtatcttgcatggcaggcgagcattattcgggagtatatgcgcgac
gaccagttcatcactcataatttcgattacgaatggcgcggtcattcctatgggttacag
cctgcggtcgaccatttccgtgccgcccgcgcactcgacatctgcggcgtcgacatctac
catccgagcgaggatgcactcaccggcaaggagatcgcattcggcggcgacatggcacgt
tcggcaggcggcggcaattacctggtgctcgaaacgcaggcacagggtcagcatggttgg
ctgccgtacccaggccaattgcgccttcaagcctacagtcatctcgcatccggtgcggat
ggaatcatgtactggcattggcattcaattcacaattcgttcgaaacgtattggcgcgga
ctgctgtcgcacgatttcgagagcaatcccacctacgaggaggccgggaggtttggacgc
gagatcggcgacccgcgtatcggagacacgctcagtcatctgtcaaaacgcaatgcggtg
gcaatcctcgccagcaacgagtcgctcaccgcgctgtcctggttccacatcgaaacggga
ttccccatgggcggcacgctcacatacaacgacgtgttgcgatccatatacgatgcattg
ttcgagctcaatgtggaggtcgatttcctgcccgcagatgcgagcgcagaccaactcgcc
ggttactccctggtgatcgcacccgcattgtataccacggatcagcagaccatcgaccga
ttggcgcggtatgttaagaatggcggtcatctgctcgccaccatgcggtcattcgttgcg
gacgagaacgtgaaagtgtggcacgacaaggcaccgcatcatcttgtcgacatatttggc
atgacctacaaccagttcactcgtccgatgggtgtatcgctcaaatgccccgacactttg
gccgacctcgccggcgcgtctgcaaacgacttcatcgagatgctctccccggctccggaa
acccacgtactcgcttggtacgaccattatgcctgggattcatatgcggcgatcaccaga
catgcattcggttccggagatgcgcagtgggtgggcacgcagcttcaggcggatgcatgg
cgcaccgtgcttgcagaggccctgtccaacgccggcgtgcacacccccggcatggaactg
gccggcacagtctgcgtgcggagcggaaccaacacggcaggcgataccgttacctacctg
ctcaactattcagggtcgcccatcaccttccgggcacccgcctcgggaacgttcctgctg
ggacatcccacagacgacggagagcaggccgtcaccgccgaaactccggtgaccgtgggc
gatgccgtcacattgccgcgttggggagtggacatcattgtcggccggcaacccacaatg
aattga

DBGET integrated database retrieval system