KEGG   Blattabacterium sp. (Nauphoeta cinerea): K645_2151Help
Entry
K645_2151         CDS       T02863                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
blu  Blattabacterium sp. (Nauphoeta cinerea)
Pathway
blu00564  Glycerophospholipid metabolism
blu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    K645_2151
Enzymes [BR:blu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     K645_2151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Lycopene_cycl HI0933_like NAD_binding_8 Pyr_redox_2 Thi4 Pyr_redox_3 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 17130755
NCBI-ProteinID: AGW86209
UniProt: U3QA08
LinkDB All DBs
Position
449958..451580
Genome map
AA seq 540 aa AA seqDB search
MMKGFLNRDRFLDILENVNIWDVIIIGGGATGLGIALDSSSRGYKTLLLEQSDFSKGTSS
RSTKLIHGGIRYLAQGNIKLVYEALQERGFLLKNAPHLVKKQKFIIPVFNWKTGIMYWAG
LKLYEWLSGSLSFGKSRFLSQKEIIRDFPEIQSKKLKGGILYYDGQFDDARLAINLAQTC
VQKGGILLNYFKVKSLLKKVGNKVSGVIACDLETKKKYSIYSKIVINATGVFSDSISKMD
ESSCPIFIKPSQGTHIVLDKYFFRSSNAIVIPKTTDGRVLFCVPWYNHVLVGTTDTFLEK
SVLEPKPLEEEIDFILQTFNKYFILHIKKSDILSAFSGLRPLFVSNNNYCSDPIQTKDIS
RSHKLIISSSGLISIIGGKWTTYRKMAEDTVNKAIEIGNLHNVPSVTKNLKIYGSYSSYD
KKSQNLYWNKYGEDEYHIKKLIEKNPLLGVSLISKDALNASYYTEAEVIWMVRYEMARTI
EDVLARRFRLLFLNAKKAIDIAPRVAALMAKELSRDDKWEKSQIDAFKKLAMQYYYPAVC
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggttttttaaatagagatagatttttagacattttagaaaatgttaatatt
tgggatgttatcattattggaggaggagcgacagggttaggaatagctttggattcttct
tcaagaggatataaaactcttctattagaacagtccgatttttctaaaggaacttctagt
agaagtacaaaattaattcatggagggattcggtatttagctcaaggaaatataaaatta
gtttatgaagcattacaagaaagaggttttttattaaaaaatgctcctcatttagtaaaa
aaacaaaaatttattattccagtcttcaattggaaaacgggaatcatgtactgggctggt
ttgaaattgtatgagtggctatctggttctttaagttttggaaaatctagatttttatcc
caaaaggaaataattagagattttccagaaattcaaagtaaaaagttaaaaggggggatt
ttatattatgacggacaatttgatgatgcacgtttagccataaatttagcacaaacttgt
gttcaaaaaggtgggatattattaaactattttaaagtcaaaagtttactaaaaaaagtt
ggaaataaagtttctggagtcattgcttgtgatcttgaaactaaaaagaaatattctatt
tattcgaaaatagttataaacgctactggagttttttctgattctatttcaaaaatggat
gaatcttcatgtcctatttttatcaaaccgagtcaaggaacacatattgtgttagataaa
tatttttttagaagttcaaatgctatagtgattccaaaaactacagatggtcgagtatta
ttttgcgtaccatggtacaatcatgttttagtaggaactacagatacttttttggaaaaa
agtgtcctcgaaccaaaacctttagaggaagaaatagattttatattacaaacttttaac
aaatattttatacttcacataaaaaaaagtgatatattaagtgcattttctggattacgt
cctctttttgtttctaataataattattgttccgatcctattcaaactaaagatatttct
aggtctcataaacttataattagttcctctggactcattagtattataggaggaaaatgg
acaacatatagaaaaatggcagaagacactgtaaataaagctattgaaataggaaatcta
cataatgtaccttctgtcacaaaaaatttaaaaatttatggatcctattcttcatatgat
aaaaaaagccagaatctttattggaataaatatggggaagatgaatatcatataaaaaaa
ttgattgaaaaaaatccccttttaggggtttccttaatttcaaaagatgccttaaatgct
tcttattataccgaagcagaagtgatttggatggttcgttatgaaatggcaagaacaatt
gaagatgttttagcgagaaggttccgtttattatttttaaatgctaaaaaagcaatagat
atagcacctagagtagctgcattaatggctaaagaactttctagagatgataaatgggaa
aaatcacaaatagatgctttcaaaaagttagctatgcaatactattatccagcagtttgc
tag

DBGET integrated database retrieval system