KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0326Help
Entry
BalV_0326         CDS       T01843                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
blv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
blv01100  Metabolic pathways
blv01110  Biosynthesis of secondary metabolites
blv01130  Biosynthesis of antibiotics
blv01230  Biosynthesis of amino acids
blv02024  Quorum sensing
Module
blv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:blv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BalV_0326
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BalV_0326
Enzymes [BR:blv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BalV_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ADG32914
LinkDB All DBs
Position
419581..420711
Genome map
AA seq 376 aa AA seqDB search
MAAMRGPDSSQDSVLDANAVVPETVDVNIRQLDPIPAPRYFIKELPLTEQMGKQVLEQRA
QIRDILHGRDDRMLAIVGPCSIHDPKAAHEYATRLAELADELKRDLLIVMRVYFQKPRTT
IGWKGLINDPDIDGEFDIRKGMWLARKVLCDVVGMGLPAATEWLDPITPQYLCDLVSWGA
IGARNTESQVHRELASGLSMPIGFKNATDGSVKPAADSCYTAAFEHHFLSINLDGHVIAA
ETKGNPDCHLVLRGSNHGPNYDAESVAAALRDLHESKAEGPSKHGLIIDAAHGNCGKNEV
VEAAVVENIAERIAGGERGILGIMMESFLKGGHQAPAPLAQLEYGQSITDSCVPWARSEE
VLRKLAQAVNARRAAR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgatgcgagggcccgacagctcacaggattcggtgcttgacgccaatgcggtg
gtgcccgagaccgtcgatgtgaacattcgtcagctcgatccgattcccgcgccacgctat
ttcatcaaggagctgccgctcaccgagcagatgggcaagcaggtgctcgagcagcgcgcg
cagatccgcgacattctgcatggccgtgacgaccgcatgcttgccattgtggggccctgt
tcgatccacgacccgaaggccgcacatgaatacgccaccagactggccgagctcgccgat
gagctcaaacgcgatctgctcatcgtcatgcgcgtgtacttccagaaaccccgtaccacc
attggctggaagggcctgatcaacgatcccgacatcgacggcgagttcgatattcgcaaa
ggcatgtggctcgcccgcaaggtgctgtgcgatgtggtgggtatggggctgcctgcggcc
acggaatggctcgacccgatcaccccgcagtacctgtgcgacttggtgagctggggtgca
atcggcgcccgcaacaccgaaagccaggtgcatcgtgaactggccagcggcctgagcatg
ccgatcggcttcaagaacgcgaccgacggctcggtcaaacccgccgccgactcctgctac
acggcggcattcgaacatcatttcctttccatcaacctcgatggccatgtgatcgccgcc
gagacgaagggcaacccggactgccatctggtgctgcgcggttccaaccacgggccgaac
tacgatgccgagtcggtggccgcggcattgcgcgacctgcatgaatcgaaggcggaaggc
cccagcaagcatgggctcatcatcgatgccgcccatggcaactgcggcaagaacgaggtg
gtcgaggcggccgtcgtcgagaacatagccgaacgcatcgccggtggcgaacgtggaata
ttgggcatcatgatggaatccttcctcaagggcggtcatcaggcgccggcgccgttggcg
caactcgaatacggacagtcgattacggactcctgtgtgccgtgggctcgtagcgaagag
gtgttgcgtaagctcgcccaggccgtgaatgcgcgtcgtgccgcacggtag

DBGET integrated database retrieval system