KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_0937Help
Entry
W7Y_0937          CDS       T02079                                 

Definition
(GenBank) Chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
blw  Bifidobacterium animalis subsp. lactis B420
Pathway
blw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
blw01100  Metabolic pathways
blw01110  Biosynthesis of secondary metabolites
blw01130  Biosynthesis of antibiotics
blw01230  Biosynthesis of amino acids
Module
blw_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:blw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    W7Y_0937
Enzymes [BR:blw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     W7Y_0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AFJ16662
LinkDB All DBs
Position
complement(1071773..1072963)
Genome map
AA seq 396 aa AA seqDB search
MLRWQTAGESHGEALVAMIEGMPSGVRVTSQDIRDALARRRLGYGRGARMKFEQDQVRLL
TGVRFGSTLGSPIAIEIGNTEWPKWTEVMSADPLDHELAREGRNAPLSRPRPGHADLTGM
RKYGFDDARPVLERSSARETASRVALGEVAALFLEQVAGIRTVSHVISIGGAGVESDNTP
LPGPDDVAALDASPVRTLDKDAEERMVARIDEAKAKADTLGGVIEVIAYGVPAGIGTYVE
SDRRLDAALAAAVMGIQAIKGVEIGDGFLEAGRPGSMAHDEMVPGDDGCIARLSNRAGGI
EGGMSNGQPIRVRAAMKPIPSIPRALRTVDITTGEAAQAINQRSDSTAVPAAAVVAEAMV
RLTLAQHLLEKFGGDSIEETRRNIEGYLASWPEHMR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgttggcagaccgcaggcgagtcccatggcgaggcgttggtggcgatgatcgag
gggatgccctcaggtgtgcgcgtgacatcgcaggacattcgcgatgcattggcgcgacgc
cgtctggggtatggccgtggggctcggatgaagttcgagcaggatcaggtgcgcctgctg
accggtgtgcgattcggcagcacgttggggtctccgatcgccatcgagataggcaacacc
gaatggccgaaatggaccgaggtgatgagcgcagacccacttgaccatgaacttgcgcgc
gagggacgcaatgcgccgttgagccgtccgcgaccggggcatgccgatctgaccggcatg
cgcaaatacggtttcgacgatgctcgtccggtgctcgaacggtccagcgcccgcgagacg
gcatcgcgcgtggcgctcggcgaagtggccgcgctgttcctggagcaggtggcgggcatt
cgaaccgtgagccatgtgatctcgattggcggtgccggtgtggagagtgacaacacgccg
ctgccgggccctgatgacgtggcggccctcgatgcctctccggtgcgcacactggacaag
gacgctgaggagcgcatggtggcccgcatcgatgaggccaaggcgaaggccgacacgttg
ggtggtgtgattgaagtcatcgcatacggtgtgccggcaggcatcggcacgtacgtggaa
tcggatcgtcggctggacgccgccctggccgccgcggtcatgggcatccaggcaatcaag
ggtgtggagatcggcgatggattcctggaggctggccgccccggttccatggcacatgat
gagatggtgccaggcgatgatggctgcattgcacgcttgtcgaatcgtgccggcggcatc
gagggcggtatgtccaacgggcagccgattcgggtgcgcgcggccatgaaaccgattccc
tccataccgcgcgccctgcgcaccgtggacatcaccaccggagaggccgcccaggccatc
aatcagcgctctgacagcaccgcagtcccggctgccgccgtggtggcggaggccatggtg
cgtctgacactggcccagcacctgctggagaaattcggaggcgacagcatcgaagagacg
cgccgcaacatcgaaggctatctggcctcgtggccggagcacatgcgttag

DBGET integrated database retrieval system