KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_1514Help
Entry
W7Y_1514          CDS       T02079                                 

Definition
(GenBank) Internalin-like protein
Organism
blw  Bifidobacterium animalis subsp. lactis B420
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8
Motif
Other DBs
NCBI-ProteinID: AFJ17221
LinkDB All DBs
Position
1786809..1787366
Genome map
AA seq 185 aa AA seqDB search
MNTLKKMAVSAVAALAGVMMVAPTAMAANGTIPIDAAHFPDTAFRVRIAQEFDSYPKDGK
LTIAERNAVTEIRGGDSYEIKFAKGIGYFPTLENLYLYNQLLTSIDLSHNAKLQNLNLSR
NKLTKIDLSRNPELRDLDLSSNKLISINVSKNTKLTEFDFQSNPLLWISSIAPAVNVDIY
SPFTD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacactctcaaaaagatggccgtcagcgctgtcgccgcactggcaggcgtgatgatg
gtggcgccgacggcaatggcagctaacggcacgattccaattgatgcagcccacttcccg
gatacagcattccgtgtacgcattgcacaggaattcgacagctatcccaaggacggcaaa
ctcaccatagcagaacgcaatgctgtcaccgaaattcgtggcggtgacagctatgagatc
aagttcgcaaagggcatcgggtattttccaaccctcgaaaatctatatttgtacaaccag
ctcttgacttctatagatttgagccacaacgcaaaactccagaatctgaatctctcccgg
aataagctgacgaaaattgatctcagcaggaacccagaactgcgcgacctcgatctcagc
tcgaacaagctgatctcaatcaatgtaagcaaaaacaccaaactcactgaattcgatttt
cagtccaacccgctgctttggataagctcgatcgcccctgcggtcaatgtcgatatctat
agccccttcaccgattaa

DBGET integrated database retrieval system