KEGG   Bifidobacterium longum BXY01: GS08_00600Help
Entry
GS08_00600        CDS       T03387                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
blx  Bifidobacterium longum BXY01
Pathway
blx00500  Starch and sucrose metabolism
blx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GS08_00600
Enzymes [BR:blx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GS08_00600
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     GS08_00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AIF89712
LinkDB All DBs
Position
complement(146328..148094)
Genome map
AA seq 588 aa AA seqDB search
MTQQPQTYPKPAWLENARFYEVYPQSFADSNGDGIGDIPGITGKLDYIAALGCNALWINP
CFDSPFKDAGYDVRDYTQVAPRYGTNDDLIALFEAAHRRGMHVLLDLVPGHTSEEHPWFQ
ASSRPNPAERTIVASSDGPSRKENTGDPTTAPSEEGAVGEADWGRDQPTNVSNRYIWTDS
WIAGGDGLPFISGETERDGTYILNFFKCQPALNYGFAHPHQAWQKPALGPDALATCDAMI
DVMRFWLARGADGFRVDMADSLVKHDDAGKPYTIHTWQYMFSKIRPEFPEAAFVAEWGRP
NESMQAGFDMDFYLDWRWDGHPNGYNLLLRNTDTPMEHEGDSSYFNADSGASIAPFLAEY
LPQLADCRAAGGHFNLISCNHDTLRTAQRLTERELKVAYGMLLTMPGCPFLYYGDEIGMR
YRALPTKEGGYVRTGSRTPMQWASDAPNLGFSTAPADALYLPTDSADDAPTVTGEASRPH
SLFNWIRSVLALRAAQPALAAGAGFSVVAAPADGRAFAYLRTAAPNDDSGDGTAAGPLLI
AMNPGRHSETVDLPNALSPDATMLLSLGEPVVGDGQLTLSPQSFAVLG
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacagccccagacttaccccaagccggcctggctggaaaacgctcgattctac
gaggtctatccgcaatcgttcgccgactcgaatggtgacggcatcggcgatattcccggc
atcaccggcaagctcgactacatcgccgctttggggtgcaacgcgctgtggatcaacccc
tgtttcgactcgccgttcaaggacgccggctatgacgtgcgcgactatacacaagtcgcg
ccgcgttacggcaccaatgacgacctgatcgcgctgttcgaagccgcccaccggcgcggc
atgcacgtgctgctcgacctggtccccggccacaccagcgaagaacacccctggttccaa
gccagctcccgcccgaaccctgctgagcgcactattgtcgcctcctccgatgggccgagc
cgtaaagaaaacaccggagacccgacaacagccccctccgaggagggggctgtcggcgaa
gccgactgggggagagaccagcccaccaatgtctccaaccgctacatctggaccgactcc
tggatcgccggcggcgacggtctgcccttcatcagcggcgagactgagcgagacggcacc
tacatcctcaacttcttcaaatgccagccggccctcaattacggtttcgcacacccgcac
caggcatggcagaaaccggcgctcggcccggatgccctggccacgtgcgacgcgatgatc
gacgtgatgcgcttctggctggcccgcggcgcggacggtttccgagtggacatggccgac
agcctcgtcaagcacgacgacgccggcaagccatacacaatccacacctggcagtacatg
ttctcgaaaatccgccctgaattccccgaggcggcgtttgtcgccgaatggggccgaccg
aacgaatcgatgcaggccgggttcgacatggacttctacctcgactggcgctgggacggc
cacccgaatggctacaacctgctgctgcgcaatactgatacgcctatggaacacgaaggc
gattccagttatttcaacgccgattcaggtgcctcaatcgccccattcctcgcggaatac
ctgccgcagctcgccgattgccgcgcggcgggcggccatttcaacctcatctcctgcaac
cacgacaccttgcgcacggcccagcgcctcaccgaacgtgagctcaaggtggcgtacggc
atgctgctgaccatgcccggctgcccgttcctctactacggcgacgaaatcggcatgcgc
taccgcgcgctgcccaccaaggaaggcggctacgtgcgcaccggcagccgcacgccgatg
caatgggcgtccgacgcaccgaatctcggcttctccacggccccggcggacgcgctgtat
ctgccgaccgattcggccgacgatgcgccgacggtgaccggcgaggcttcgcgaccgcat
tcgctgttcaactggatccgctcagtactggcattgcgcgccgcccagccggcactggcc
gccggcgccgggttcagcgtggtcgccgcgcccgcggacggccgcgcgttcgcctatctg
cgcacggccgcgccgaacgacgacagcggcgacggcacggcggccgggcctctcctcatc
gccatgaatccgggccgccacagcgaaaccgtggacctgccgaacgcactctcccccgat
gccaccatgctgctcagcctcggcgagccggtcgtgggcgacgggcagctgacgctctcc
ccgcagtcgttcgccgtgctcggatag

DBGET integrated database retrieval system