KEGG   Brevibacterium linens BS258: A2T55_02850Help
Entry
A2T55_02850       CDS       T04319                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bly  Brevibacterium linens BS258
Pathway
bly00020  Citrate cycle (TCA cycle)
bly00190  Oxidative phosphorylation
bly00650  Butanoate metabolism
bly01100  Metabolic pathways
bly01110  Biosynthesis of secondary metabolites
bly01120  Microbial metabolism in diverse environments
bly01130  Biosynthesis of antibiotics
bly01200  Carbon metabolism
Module
bly_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bly_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bly_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A2T55_02850
   00650 Butanoate metabolism
    A2T55_02850
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A2T55_02850
Enzymes [BR:bly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A2T55_02850
    1.3.5.4  fumarate reductase (quinol)
     A2T55_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like DAO FAD_binding_3 Pyr_redox_3 AlaDh_PNT_C GIDA
Motif
Other DBs
NCBI-ProteinID: AMT92862
UniProt: A0A144MB12
LinkDB All DBs
Position
672275..674032
Genome map
AA seq 585 aa AA seqDB search
MNTTQDGSRRKEHSISTSVLVIGTGGSGLRAAIEVAESGADVLAVGKRPKEDAHTSLAAG
GINAALATMDPDDTWQQHAADTIKESYDLANPRTVEIVTQGAAEGIADLERYGMDFAKED
DGRISQRFFGAHTWRRTAFAGDYTGLEIQRTLIRRAESLNIPILDRVYITKLLVSGGRIF
GAYGFDVIDGTGYRIHADAVILAAGGHNRIWRRTSSRRDENTGDSFRLAVEAGARLRDAE
LVQFHPSGIIEPENAAGTLVSEAARGEGGILRNGLGERFMERYDPQRMELSTRDRVALAA
YTEIAEGRGTENGGVWLDVSHLPRETIMNRLPRVFATLMETQMLDITTSPIEIAPTAHYS
MGGVWVDPVDHSTDVEGLWAIGEASSGLHGANRLGGNSLIELLVFGRIVGRSAVAYSDSL
EAQVRSHAAVDEARAEISALLASEGTENVRALQREVRNLMTEHAGVVRDEAGLLAGLEKL
ATIEARLELVGIHPDIAGFADLAHAFDLKSSVLAARATLECALERRETRGCHNRSDYPEL
DPNLQVNLVWSPSVGVVRESIPAVSADVAALMHTGEISQEGKLVE
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacacaggacggatcccgccgtaaagaacactccatctccacctcggtgctg
gtcatcggaaccggtggatcgggtctgcgggccgcgatcgaggtcgccgaatccggggcc
gacgtcctcgctgtcggcaaacggccgaaggaggacgcccacacctcgctggcagccggc
ggcatcaacgcggccctggcgacgatggacccggacgacacctggcagcagcacgcggcc
gacacgatcaaggaatcctatgacctcgccaacccccgcaccgtcgagatcgtcacccag
ggagcagccgaaggcatcgctgacctggagcgatatggaatggacttcgcgaaggaggac
gacggtcggatctctcagcgcttcttcggcgcccacacctggcgtcgcaccgctttcgcc
ggcgactacacggggctggaaatccagcgcaccctcattcgtcgcgccgaatccctgaac
atccccatcctcgaccgcgtctacatcacgaagctgctcgtctcaggcggtcgcatcttc
ggtgcctacggcttcgacgtcatcgacggcaccgggtaccggatccacgccgacgccgtc
atcctcgccgccggcggacacaaccggatctggcgacggacctcgtctcgccgggatgag
aacaccggtgactccttccgcctggctgtcgaggccggcgcccgactgcgcgatgccgaa
ctcgtccagttccacccctcgggcatcatcgaacccgagaacgctgcgggcacgctggtt
tccgaggcggcccgcggtgagggagggatcctgcgcaacggtctgggggagcggttcatg
gagcgctacgacccgcagcgcatggaactctcgacgcgtgaccgggtggccctggccgcg
tacacggagatcgccgaggggcgcggcaccgagaacgggggagtgtggctcgacgtgtcc
cacctgccgcgcgagaccatcatgaaccggctgccgcgcgtgttcgccacactcatggag
acgcagatgctcgacatcacgacctcgccgatcgagatcgctccgaccgcccactactcg
atgggaggagtgtgggtcgacccggtcgatcacagcaccgacgtcgaaggcctgtgggcc
atcggtgaggcgtcgtccggtctgcacggggcgaaccggttgggcgggaactcgctcatc
gagctcctcgtcttcggtcggatcgtcggtcggtcagccgttgcgtactccgattcgttg
gaggctcaggtgcggtcacatgccgcggttgatgaggccagggccgagatctccgctctg
ctggcatccgagggcacggagaacgtgcgtgccctgcagcgggaggtccgcaatctcatg
accgagcacgccggagtcgttcgcgacgaggccggtctgctcgccggcttggagaagctc
gcaacgatcgaggccaggctcgagctcgtcggcatccaccccgatatcgccgggttcgcc
gacctcgcacacgccttcgacctcaagtcctcggtgctcgcggcacgggcgacgctcgaa
tgtgcgctggagcgtcgggagacccgcggctgccataaccgcagcgactacccggaactg
gacccgaacctgcaggtcaatttggtctggtctccgtcggtcggagtcgtccgcgagtcg
atccctgcagtttcggcggacgtcgcggcgctcatgcacaccggtgaaatcagccaagaa
ggcaaactcgtcgaataa

DBGET integrated database retrieval system