KEGG   Brevibacterium linens BS258: A2T55_05855Help
Entry
A2T55_05855       CDS       T04319                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bly  Brevibacterium linens BS258
Pathway
bly00010  Glycolysis / Gluconeogenesis
bly00030  Pentose phosphate pathway
bly00051  Fructose and mannose metabolism
bly00052  Galactose metabolism
bly00680  Methane metabolism
bly01100  Metabolic pathways
bly01110  Biosynthesis of secondary metabolites
bly01120  Microbial metabolism in diverse environments
bly01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2T55_05855
   00030 Pentose phosphate pathway
    A2T55_05855
   00051 Fructose and mannose metabolism
    A2T55_05855
   00052 Galactose metabolism
    A2T55_05855
  09102 Energy metabolism
   00680 Methane metabolism
    A2T55_05855
Enzymes [BR:bly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A2T55_05855
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     A2T55_05855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AMT93358
UniProt: A0A0B9ATS4
LinkDB All DBs
Position
complement(1339793..1340818)
Genome map
AA seq 341 aa AA seqDB search
MKIGVLTSGGDCPGLNAVIRGIVRKGIRTHDASFVGIRDGWRGLLEDDMFDMTMLDVRGL
SGRGGTILGTSRTHPYEDGGPERMREVMAAHGIDSLIAIGGEGTLAGASRLVQEEGLHIV
GVPKTIDNDLGNTDYTFGFDTAQSIATEAIDRLRTTAESHHRCMVIEVMGRNVGWIALHA
GMAAGAHAILMPEFPVSFDQIAEWVTSAKDRGRAPIVVVAEGFVPEGFDSQVADQGVDSR
GRVRLGGIANYLAPQIEEITGIESRATILGHLQRGGSPTAYDRVLSTRLGMAAADLAQHG
HWGKMASLKGTDIVSVEMSSAVHSLKSVPLHRWEEAQVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggtgtactcacctcgggcggagactgcccgggactcaatgctgtcatccgc
ggcatcgtccgcaagggaatccgcactcacgatgcctcgttcgtcggcatccgcgacgga
tggcggggtctcctcgaagacgacatgttcgatatgacgatgctcgacgtgcgtggcctc
tccggccgcggcggaaccatcctcggcacctcccgcactcacccctatgaggacggcggt
cccgaacgcatgcgcgaagtcatggccgcccacggcatcgattcgctcatcgccatcggc
ggcgaaggcaccctcgccggggcctccaggctcgtccaggaggagggactgcacatcgtg
ggcgtccccaagaccatcgacaacgacctcggcaacacggactacaccttcgggttcgac
accgcgcagtccatcgccacggaagcgatcgaccggctgcgcaccactgcggagtcccac
caccgctgcatggtcatcgaggtcatgggacgcaacgtcggctggatcgctctgcatgcg
ggcatggccgccggcgcccatgcgatcctcatgcccgagttccctgtctccttcgaccag
atcgccgaatgggtgacctcggcgaaggatcgcgggcgtgccccgatcgtcgtcgtcgcc
gaaggcttcgttcccgaaggcttcgactcccaggtcgccgatcagggagtcgacagcagg
ggtcgggtccgcctcggcggcatcgcgaactacctcgcaccgcagatcgaagagatcacc
gggatcgaatcccgagccacgatcctcgggcacctgcaacgaggcggctcccccaccgcg
tacgaccgtgtgctgtccacccggttgggcatggcagccgctgacctcgctcagcacggg
cattgggggaagatggccagcctcaagggcacagacatcgtctccgtggagatgtcctcg
gccgtgcacagcctcaaatcggtgccgctgcaccgctgggaagaggcacaggtgctcttc
ggctga

DBGET integrated database retrieval system