KEGG   Brevibacterium linens BS258: A2T55_12015
Entry
A2T55_12015       CDS       T04319                                 

Definition
(GenBank) thiamine-monophosphate kinase
  KO
K00946  thiamine-monophosphate kinase [EC:2.7.4.16]
Organism
bly  Brevibacterium linens BS258
Pathway
bly00730  Thiamine metabolism
bly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bly00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A2T55_12015
Enzymes [BR:bly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.16  thiamine-phosphate kinase
     A2T55_12015
SSDB
Motif
Pfam: AIRS AIRS_C
Other DBs
NCBI-ProteinID: AMT94411
UniProt: A0A142NQY0
LinkDB
Position
complement(2715092..2716141)
AA seq 349 aa
MTRLSELGESHIISRVLTRNPEPAHVIVGPGDDAAVTAPEGRLVSTADMLVENEDFTRDW
LDWELLGRKAAAQNLADVCAMGATPHGLLVSLAVPNDTDITDIEALYSGLFEEAERAGTA
LECTVPIIGGDLSSSKLIVIAITALGTVQEDSATLRSGARPGDSLYLAGTVGRAAAGLDL
LFAGLRRDTAGPELRSLIDTQLAPQPDYGALRTVGAASAMIDVSDGLSLDLARVAAASGV
GIDLERALLDDLVDPLLPAAEYVLDSRAKGVSGDAEGVADSANGPVMTAEDLALSWVLDG
GEDHGFAASASPRQDPGVGWRRIGEIRTGHDVSLDGTPVPASGFSHFGK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacccgactgtccgaacttggcgaatcacacatcatctcccgcgtgctcacccgcaac
cctgagcccgcacacgtgatcgtcggacccggagacgatgcggccgtgaccgcaccggag
ggtcgactcgtctcaaccgcagacatgctcgtggagaatgaggacttcacccgcgactgg
ttggactgggaattgctcggacgcaaggccgcggcacagaacctcgccgacgtctgcgcc
atgggtgcgaccccgcacggacttctcgtatccctggcggtaccgaatgacacggacatc
accgacatcgaagccctgtattccggactcttcgaggaggcggagcgggcaggcaccgcg
ttggagtgcacagtgccgatcatcggcggcgacctgtcctcctcgaaactcatcgtcatc
gccatcaccgcgctcgggacggtgcaggaggattccgcgacactgcgctccggtgctcgc
cccggtgattcgctctatctggccgggacggtcggacgcgcggccgccggactcgacctg
ctcttcgccggcctgcgacgcgataccgccggcccggaactgcgctccctcatcgacacc
caactggccccgcagcccgactacggtgcactgcgcacggtcggggccgcctcggcgatg
atcgacgtctccgatggactcagcctcgacctcgcccgagtggcggccgcctcgggggtg
ggaatcgacctcgagcgggccctgttggacgacctcgtcgacccgttgctgccggcggcc
gagtacgtgctcgattcgcgggcaaagggagtctccggcgacgcggagggtgtggcggat
tcggcgaatggccctgttatgacggcagaggacttggcactgtcctgggtcctcgacggg
ggagaagaccacggcttcgccgcgtctgcgtcgccgcgtcaggaccctggagtaggctgg
cggagaatcggtgagatccgcaccggacacgatgtcagcctcgacggcacacccgtgccg
gcgagcggtttcagccatttcgggaagtga

DBGET integrated database retrieval system