KEGG   Brevibacterium linens BS258: A2T55_16505Help
Entry
A2T55_16505       CDS       T04319                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
bly  Brevibacterium linens BS258
Pathway
bly00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bly01100  Metabolic pathways
bly01110  Biosynthesis of secondary metabolites
bly01130  Biosynthesis of antibiotics
bly01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A2T55_16505
Enzymes [BR:bly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     A2T55_16505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AMT95113
UniProt: A0A144MJB5
LinkDB All DBs
Position
3723055..3723993
Genome map
AA seq 312 aa AA seqDB search
MSLNRFAYLGPEATFTEAALLSFLDSRNLRAEATTHPMRNAPSALDAVLEGDCDAAVVPI
ENSLEGGVPATIDALTENGRLQIIAEVVVPVRFVLAVKPGTTREEISSFGSHPHGEAQVR
AFMNENFPEAVYLPTSSTAAAARDLANDAGDHMAAVCPALAAQRYGLEIVAEDIGDRKDA
VTRFVVVTRPGPLPAPTGADKTTVVAALRSDRAGSLLELLEQFSSRGVNMSRIESRPTGD
GLGLYQFSIDLLGHIHEARMAEALQGVHRAALKLHFLGSYPSSDGAVVPVDPTTTDESFA
AAADWLEHTLEG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcaaccgtttcgcgtacctcggccctgaggccactttcaccgaggcggccctg
ctcagcttcctcgactcccggaacctgcgcgccgaggccacgacgcacccgatgcgcaat
gccccctcggcactcgacgcggtgctcgagggagactgcgatgccgcggtcgtgccgatc
gagaactcactggaaggcggagtgcccgccacgatcgatgcgctcaccgagaacgggcgt
ctgcagatcatcgccgaggtggtcgtgcccgtccgcttcgtcctcgccgtcaagcccggc
accaccagggaggagatctcctccttcggttcgcacccgcacggcgaggcgcaggtgcgg
gcgttcatgaacgagaacttccccgaagccgtctacctgccgacgtcctcgactgccgcg
gccgccagggacctggccaatgacgccggcgaccatatggccgccgtctgcccggccctg
gccgcgcagcgctatggactcgagatcgtcgccgaggacatcggcgaccgcaaagacgcc
gtcacccgattcgtcgtggtcacccgcccgggccctctgcccgccccgaccggcgcggac
aagactaccgtggtggcagccctgcgctcggaccgggcgggttcgctgctcgaactgctc
gaacagttctccagccgcggggtcaatatgtcccgcatcgaatcccggccgaccggtgac
gggttgggcctctaccagttctccatcgacctgctcggacacatccacgaggcccgcatg
gccgaggccctgcagggtgtccaccgggcggccctcaagctgcacttcctcggcagctac
ccgagctccgacggagcagtggtgccggtcgacccgacaacgacggacgagtccttcgcc
gccgccgccgattggctggaacacaccctcgaaggctga

DBGET integrated database retrieval system