KEGG   Bifidobacterium longum subsp. longum GT15: BLGT_09165Help
Entry
BLGT_09165        CDS       T03452                                 

Definition
(GenBank) membrane protein
Organism
blz  Bifidobacterium longum subsp. longum GT15
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ESCRT-II Clr2 FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AIW44305
UniProt: A0A0A0UC39
LinkDB All DBs
Position
complement(2105145..2106569)
Genome map
AA seq 474 aa AA seqDB search
MGYESLSTVVVLVIVAIIIVVWLPVRTANGMKRVDEHRQDRYSPSLHIVDAENGRRFGDI
KPHKAKGAAMPASTPSARLTSEHIAHVRELRRAAIRRRQILAVCLLAITVLVFAVSFPLH
FSPLLALIPFVLLLLVLVLGANASRQARQWERKVVRYERAHSGTGWSKKPSAESKDSKRV
NKAEPVAAVTAPAEKPAEQIEDAATEVMEQRQIRRALRDAEIEQAKAKALRQSAAAYQAA
EEHAKQSEKSDIAQSAADKPAAEPSAMVDESADRKSAAETSESSATPDASVRTDKSIESD
KSVAPRVEPSLTVRDERDERDDAAAAADATSELVSVRPARALDVFDMSTSQDLISFTLGG
EHNADNAPESLEIKSTRQVSKAEPVEPAVAEKLIDEARAVKAADDAKAVSAGNAVDTEPE
QRDDADTDADDEAANAAQRAAFHESEERADVEAPAATTDSLGAGLDSILARRGN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgagtcactgagcactgtcgtcgtgctggtgattgtggcgattattatcgtt
gtatggctgcccgtacgtacggccaacggcatgaaacgtgtggacgagcaccggcaggat
cgttattcgccttccctgcatatcgttgatgcagagaacggcagacgattcggagacatc
aagccgcataaggcgaaaggggcagcaatgccagcatcaacaccgtcagcgaggctgaca
tctgagcacatcgcccatgtgcgggaactgcgccgcgcggccatccgccgccggcagatt
ctcgccgtatgcctgcttgccataaccgtgttggtgtttgccgtatcgttccccctgcat
ttcagtccgctgcttgctcttattccgttcgtgctgttgctgctggtgctggtgctggga
gccaatgcctcacgccaggcccggcaatgggagcgcaaggtggtccgctacgagcgggct
catagcggtacgggctggtccaagaaaccgtctgccgagtccaaggacagcaagcgtgtg
aacaaggccgaaccggttgcggccgtaactgcgcctgccgagaagcctgccgagcagatt
gaggatgctgccaccgaggtcatggaacagcggcagattcgccgcgcgctacgcgatgcc
gagattgagcaggccaaggccaaggcgttgcgtcagtccgccgccgcatatcaggccgcg
gaagagcacgccaaacagtctgagaagtctgatattgcacagtccgccgccgataagcct
gccgccgagccgtctgctatggtcgatgaatccgccgaccgtaagtccgctgccgaaacc
agcgaatcttccgccacacctgatgcctccgttcgcacagacaagtcgattgagtcggac
aagtccgtcgcccctcgagttgaaccatcgcttacggtgcgtgacgagcgcgatgagcgc
gacgatgccgctgccgctgccgatgccacgtcggaactggtcagcgtacgccctgcccga
gcactggacgtcttcgatatgtccacctcgcaggatctcatctccttcactttgggtggg
gaacataacgccgacaacgctccggaaagcttggagatcaagtcgacccgtcaggtgtcc
aaggcggaacctgtcgaacccgcagtggcggaaaagttgattgacgaggcccgagccgtc
aaggccgcggacgacgccaaggctgtcagcgccggaaacgctgtagacactgagccggag
cagcgcgatgatgccgatacggacgccgatgacgaggctgcaaacgccgcccagcgagcc
gcattccacgaatccgaggagcgtgccgacgtcgaagcgccagcggcgaccaccgattcg
ttgggcgcaggcctggactccattcttgcccgccgcggcaactga

DBGET integrated database retrieval system