KEGG   Bifidobacterium longum subsp. longum GT15: BLGT_09175Help
Entry
BLGT_09175        CDS       T03452                                 

Definition
(GenBank) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
blz  Bifidobacterium longum subsp. longum GT15
Pathway
blz00670  One carbon pool by folate
blz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BLGT_09175
Enzymes [BR:blz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     BLGT_09175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-FTHF_cyc-lig
Motif
Other DBs
NCBI-ProteinID: AIW44307
UniProt: A0A0A0UD58
LinkDB All DBs
Position
2107372..2108121
Genome map
AA seq 249 aa AA seqDB search
MCGMSEVGSGMNIGSDYSGTEKTEKTDKATLRHHILSRRKRVPAEERGAAGELLVRRFPA
HMIQDGPTVAAYVSMGSEIETRPLLRWLRAHGCHVLVPRLGSGLEIGWSVLDSLESLRSM
DAVGGANNAGSCSSPSTVHHRPDEPTGAVLPPEALEKANLVIAPALAVDPQGNRLGRGAG
WYDRALARRKPACPLIAVCWPWEVLDIDLPAEPHDVPADGVLTPEGYRRLSSSGLLSWPA
GQDTRRKPD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcggtatgagcgaagtgggcagtggcatgaatatcggcagcgactacagcggcaca
gagaaaacagagaagacggataaagcgacgctgcgccaccatatactgtctcggcgcaag
cgcgttccagcggaagaacgcggagcggccggtgaattgctggtgcgacggttcccagca
cacatgattcaggatggtcccacagtggcggcatatgtgtcgatgggttcggaaatcgaa
acccggccactgttgcgatggctgcgggctcatggctgccacgtgttggtgccaaggttg
gggtctgggttggaaattggctggagtgtgctggattcattggaatcattgcgctcgatg
gatgcagtgggtggcgcgaacaatgccggtagctgcagctctcccagcaccgtccatcac
agacccgatgagccaactggcgcagttctaccgcccgaagcgttggagaaggccaatctg
gtcatcgctccggctttggcagtggacccgcagggcaatcgtctggggcgtggagccggc
tggtatgaccgggccttggctcgccgcaagcccgcatgtcccctgattgcggtgtgctgg
ccgtgggaggtgttggacattgatttgccggccgaaccacatgatgtgccggccgacgga
gtgctgacgccggagggataccggcggcttagctcatcgggcctgttgagctggccggcc
ggccaagatactcggcgcaagccagactga

DBGET integrated database retrieval system