KEGG   Bifidobacterium longum subsp. longum GT15: BLGT_09195Help
Entry
BLGT_09195        CDS       T03452                                 

Definition
(GenBank) helicase
Organism
blz  Bifidobacterium longum subsp. longum GT15
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTES_1575
Motif
Other DBs
NCBI-ProteinID: AIW44311
UniProt: A0A0A0UJN2
LinkDB All DBs
Position
complement(2109575..2113198)
Genome map
AA seq 1207 aa AA seqDB search
MTQSQTQNQNLTEGLNRIRRWRDQYRSMQPPSPLEDVNQLAAKLEMTHAHPSGIAQLFAS
GHVRLDSLFRDTGVLKAAERHIGRVLDDQAAKRRISGVAELSLVVGVATWKGNALPVLLY
PVSVTIEDDGLSTTIRFTGRVALNVAFVNTLREQGVFLDEDSLFDGASYDSGTPETSAMF
ARISSEASERISDFAIERQIVLGCFMDPSSQMISESRQFIDQLENGPTGNVLLDALAGDE
SARTALKDANIPQYSPFDVDPHAEYEVGDVDNTVRYAASLAANGHSIVVDGTFPKGTAEQ
AVAIASRCLMNGRSVLYVPGVAEQKRLFIQTASANEMKAQVLDVSDEHANAALDKQLIAA
VGFQPGVATQRFDQLADELVGVRSRLTRYLGDLHGGNDKWNVSAYETIQNLARISVLPTH
PATHVRLDELSALSIANDIDTWIGKMERAGELGEYTIGPEDTAWYKASITTEEQAVTAYQ
RVDDLLRRFLPATREQVARTVQTCGFPVPPTTREWERQVTVLKNLRRVLDVFQPEIFERD
ISSMIEATKPKSQRKAEGTSMGFWERRRHIKEAKDLLRVGAQVEDLHEALKVVAKQGEQW
HQFVPHGGWPVLPSKLDEIISTQEALVSNMTALDTVLSTTPAGGNLETADFEKVEARLKA
LLDDRKALDTLPERCLLEQEFASAGLNELVADLNARRVSVEQVRGEVQLAWWTTVFEDIV
RSSAIISNQDGAALQAASDRFAQVDVEHVRSIGPMVSQESMRRLCDMLFSRTQEANQMHT
VLAGRASVSLSRIRRDHPEILAAAKPILVAAPGTLAALTEPGVLADVAILDACAHIPAIE
LLSIIGRVQQVVVIAHCATVTSESVKQLIDTLPHIEVDAAPSRRAPRLSAFLESEGYGPV
RYDVATEPAAGEVRFHRVEASGVPVMSSGLVESSQPEIDEVVRLITQRAAGFAVVPSSYR
LVVVMLTDAFRTRLGAELKSLAGKSKAMGRFLRHVRLVSLRDVAGGRATDVILSMCYAKT
THGRLLQQFGPLESTGGRGLLLDALALADHSLDIVSAFGSEDLDEERLHQSGPRFLKTML
TWAEQLDDRPVLPLRDAAGGNVLFDDIADRLRARGLNAAVDYGFDKGVKIPLVVGLKDKP
FALAVQTDDANFMSVQSTRRRHRLSAQDLISLGWNVMTVWSVAAFVNPDKEVDRIVSRIG
EIYREVE
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atgacccagagccagactcagaaccagaatctcacggaaggtctgaatcgcatccgtcgc
tggcgtgaccaataccgcagcatgcagccgccatcgccgctcgaggatgtgaatcaactg
gccgcgaagctggagatgacccatgcccatccctccggcatcgcccagctgttcgcttcc
ggccatgtccggttggattcgttgttccgcgacacgggtgtgcttaaggccgccgaacgc
catattgggcgcgtgctggatgaccaggccgccaaacgcaggatttccggcgtggcggag
ttgtcgctcgtggtcggcgtggccacgtggaagggcaacgcgctgccggtgctgttgtac
ccggtgagcgtcacgatcgaggatgatggcttgtcgaccaccattcgattcaccggtcgc
gtggccctgaacgtcgcgttcgtcaatacattgcgtgagcagggggtgttcctggatgag
gattccctgtttgacggtgccagctatgacagtggcactcccgaaacttccgcgatgttc
gcccgtatttcgtccgaagcgtcggagcgtatctccgacttcgccatcgagcgccagatt
gtgctcggatgcttcatggacccctcgtcgcagatgatcagcgaaagccgacagttcatc
gaccagctggagaacggccccaccggcaatgtgctgttggacgcgcttgccggcgacgaa
tccgcccgcaccgcgctcaaagatgccaatattccgcaatacagtcctttcgacgtagac
ccgcatgccgagtacgaagtcggcgatgtggacaatacggtgcgatatgccgcgtcactt
gctgccaatggccatagcatcgtggtcgacggcaccttcccgaagggcaccgcggagcag
gctgtggccatcgcatcgcgctgcctgatgaatggtcgttccgtgctgtacgtgcccggc
gtggccgagcagaagcgtctgttcatccagacggcttccgccaatgagatgaaggcgcag
gtactggatgtatccgatgaacacgccaacgccgcgcttgataagcagctgattgccgca
gtcggattccagcccggagtcgccacccagcgattcgaccagctggccgacgaactcgtg
ggcgtgcgctcgcgcttgacccgctatctgggcgacctgcacgggggcaacgataagtgg
aatgtgtccgcatacgagaccattcagaatctggcccgtatctccgtgctcccgacgcac
cctgccacccacgttcgacttgacgagttaagtgccctgagcatcgccaacgatattgac
acatggatcggcaagatggaacgcgccggcgagctcggcgaatacaccatcggcccggaa
gacaccgcatggtacaaggcgtccatcaccactgaagaacaggcagtaaccgcctaccag
cgcgtggacgatttgctgcgtcgcttcctgcccgccacccgtgagcaggtggcacgcacc
gtgcagacctgcggattcccggttcctcccaccacccgcgagtgggagcgtcaggttacg
gttttgaagaatctgcgacgagtgcttgacgtgttccagccggagattttcgagcgagac
atcagctccatgatcgaggccaccaagccgaagagccagcgcaaggccgagggcacgtcg
atgggattctgggagcgccgccgccacatcaaggaagccaaggatctgctgcgcgtcggc
gcgcaggtcgaggacttgcacgaagcgttgaaggtagtcgccaagcaaggggagcagtgg
catcagttcgtgcctcacggcggttggccggtgctgcccagcaagctcgacgagatcatc
tccacccaagaggcgctggtcagcaatatgaccgcgctggataccgtgctttccaccaca
cccgctggtggcaatctggaaaccgccgatttcgagaaggtggaagcacgcctgaaagca
ctgctggatgatcgcaaggcactggacaccttgccggagcgttgcctgctggagcaggaa
ttcgcctctgccggactgaacgaactggtcgccgatctcaacgctcgccgagtgagcgtg
gagcaggtgcgcggcgaagtgcagctggcctggtggaccaccgtgtttgaggacattgtg
cgttcgtccgccatcatctccaaccaggatggtgccgcgctgcaggccgcatccgaccgc
tttgcgcaggtcgatgtggagcacgtgcgctccatcggaccgatggtgtcgcaggaatcc
atgcgccgcctgtgcgacatgctgttctcccgcactcaggaagccaaccagatgcacacc
gtgctggcagggcgcgccagtgtgtcgctgagcaggattcgccgtgatcatccggagatt
ctggccgcggccaagccgattctggtggccgcgccgggtacgctcgccgcactcaccgag
ccgggtgtgctggctgatgtggcgattctcgatgcgtgcgcgcacattcccgctatcgag
ttgctgtccatcatcggccgcgtgcagcaggtggtggtgatcgcccactgcgcgacggta
accagcgaaagcgtcaagcagctgatcgacacgttgcctcatatcgaggtggatgctgcc
ccgtctcgccgtgcgccgcgcctgtccgcattccttgaatccgagggatatggtcctgtt
cgctatgatgtggccaccgagccggctgccggtgaggtgcgattccaccgtgtggaagcg
agcggtgtgccggttatgtcttctggtctggtggaatccagccagccggagattgatgaa
gtggtgcgtctgattacgcaacgtgccgccggttttgccgtggttccttccagctatcga
cttgtggtcgtgatgttgaccgacgcattccgcacacgcttgggtgccgaattgaagtcg
ttggcaggcaaatccaaggcgatgggccgattcctgcgccatgtgcggttggtttccttg
cgtgacgtggccggaggtcgtgccactgacgtgattctgtcgatgtgctatgcgaaaacc
acgcacggacgtctgcttcagcagttcggtccgctcgaaagcacaggcggtcgcggactg
ttgctggatgccctggcattggcggaccacagcttggatattgtgtcggcctttggttcc
gaagatttggatgaagaacgactgcaccaatccggtcctcggttcctgaagaccatgttg
acgtgggccgaacagcttgacgaccgtccggtgcttccgttgcgtgatgcggcaggcggc
aacgtgctgttcgacgatatcgccgacaggttgcgcgcgcgaggactgaacgctgctgtt
gattatggattcgacaagggcgtgaagattccgctcgtggtgggattgaaggacaagccg
tttgccttggccgtgcagaccgatgacgcgaactttatgtccgtgcaatccacgcgtagg
cgtcatcgtttgtcggcacaggatctcatttccttgggctggaatgtgatgaccgtctgg
agtgtcgccgccttcgtaaaccccgataaggaagtcgaccgtatcgtcagccgtatcggt
gagatctatcgcgaggttgaataa

DBGET integrated database retrieval system