KEGG   Bifidobacterium longum subsp. longum GT15: BLGT_09200Help
Entry
BLGT_09200        CDS       T03452                                 

Definition
(GenBank) signal peptide protein
Organism
blz  Bifidobacterium longum subsp. longum GT15
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-ProteinID: AIW44312
UniProt: A0A0A0UD60
LinkDB All DBs
Position
complement(2113207..2114700)
Genome map
AA seq 497 aa AA seqDB search
MSEWTVKINGVDRISVKPGECVEIGRKPLRPLADDGNTRLDVADQTKSMSKRHAMFTVKS
NGTASVRDLGSTNGSYVVRENGDLLRLPANAEFLLPTSPMRMQFGDVPADFIRVDDPVAK
PLDLKVPDLFGYAVHEAPQEPDAADMSVDDILDLRAGEPTAIFSADNVRRKVDELELGSL
NITQPVTKNDESAIPRDLFADALAQHAEQETERKNQQAMNSVALPKQQTEPESTIVTPAS
KHSRISGIVPVDAIAHAVVKHAPSTSEPAVASAAVVESDVVAGASKSAENVQSAPNTRNA
GDSQPADTVEQHAEVAQPEAAREAEAAQSENTQPETAQPATAQSETDQPAADVPDDQQRT
AAEAYQEATAAGVADQQPAAETAQQSVSEAYDIDSTGVHTPVFEPGSVFERVAKGELKAQ
EPAVEVDGLTSDEAKTTQDFNVQFEVARHPELLAFLAMNPYLYDDMYSWLAARGEADIDE
ALSHNKGYQEYREAVGK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagtggacggtgaagatcaacggtgtcgaccggatcagcgtcaagccgggggag
tgcgtggaaatcggccgtaagccgttacgcccccttgccgatgatggcaacacccgcctt
gacgtcgccgatcaaaccaaatcgatgtccaaacggcacgccatgttcacggtaaaaagc
aatggcacggcctcggtccgtgatcttggatcgaccaatggatcgtatgtggtgcgggaa
aatggcgatttgttgcgcttgccggccaatgccgagttcctgttgccgacgtctcccatg
cgcatgcagttcggcgatgtgcctgcggacttcattcgtgtcgacgatccagtggcaaag
ccgctcgacctcaaggtgcctgatttgtttggctatgcggttcacgaagcaccgcaggag
ccggatgcggcggatatgtccgtcgacgatattcttgatttgcgggccggcgagccgacc
gccatcttcagcgcggataatgttcgacgcaaggtcgacgagcttgaacttggctcgctg
aatatcacgcagccagtgacgaaaaacgatgagtcggccataccccgtgatctgttcgcg
gatgcgttggcccagcatgccgagcaggagaccgaacgcaaaaaccagcaggccatgaac
tccgtggcactgccgaagcagcagaccgaacctgagtcgacgattgtaacgcctgcatcc
aagcacagcaggatctccggtattgttccagtagatgccatcgcccatgccgttgttaag
cacgctcccagcacaagcgagccggcagtggcgtcggcggcggttgttgaatccgatgtg
gtggctggcgcaagcaagtcagccgaaaacgttcagtccgctccgaataccaggaatgcc
ggcgattctcagccggcggacactgtcgaacagcatgctgaagttgcccagcctgaagcc
gcccgggaagccgaagccgctcaatctgaaaacacccagcctgagaccgctcagccggca
accgcccagtctgaaaccgaccagccggcagctgacgtaccggacgatcagcagcggacc
gcagccgaagcatatcaagaagccaccgcagcaggcgtagcagaccagcagccggctgcc
gaaaccgcccagcagtcggtatccgaagcatatgatatcgactccacgggcgtacacact
ccggtcttcgagcccggctcggtgttcgagcgtgtggccaagggcgagctgaaagcacag
gagccggcagtcgaagtcgatggcctgacctctgacgaggcaaaaaccacgcaagatttc
aatgttcaattcgaagtcgcccgtcatcccgaattgctggcgttcctcgccatgaatccg
tacctgtacgacgacatgtattcttggctcgccgcccgtggcgaggccgatattgacgaa
gccctgtctcacaacaagggctatcaggaataccgcgaagcggttggaaagtga

DBGET integrated database retrieval system