KEGG   Burkholderia mallei ATCC 23344: BMA0241Help
Entry
BMA0241           CDS       T00204                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00564  Glycerophospholipid metabolism
bma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMA0241 (glpD)
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BMA0241 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 3089865
NCBI-ProteinID: YP_102073
UniProt: A0A0H2WHM9
LinkDB All DBs
Position
1:complement(259814..261346)
Genome map
AA seq 510 aa AA seqDB search
MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTSSSSTKLIHGGLRYLE
YKEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELL
PGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNALDAQERGARILTRTKLVS
AERRDGQWHARLQRADGSTLDVRARAIANAAGPWVGEVLHGALGRGAQHSVRLVKGSHII
TPRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYRDDPSRVAIDRDETRYLCES
INRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDYRLELDDGEGAPLLSVFGGKI
TTFRKLAEEATDMLGGALGAARGAWTAGVPLPGGDIANARFAPFAEAFAKRHPWLPAALA
RRYARAYGTRAERVIGRARSHAELGVQLAPGLYEAELRYLRDVEWAGCADDVLWRRSKLG
LHVAPGTLEPVTAALDAWFGAAREAASAAH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaacagaatcgttacgatctgctcgtcgtcggcggcgggatcaacggcgcgggc
atcgcgcgcgatgcggccggccgcggcctgtcggtgctcctttgcgagcaggacgacctc
gcgtcgcacacctcctcttcgagcacgaagctgatccacggcgggttgcgctacctcgaa
tacaaggaattcgggctcgtgcgcaaggcgctgcaggaacgcgaaacgctgctgcgcgcg
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgccgaacctgcgcccc
gcgtggctcatccggatcggcctcttcctgtacgaccatctcgcgaaacgcgagctgctg
ccgggctcgcgcggcatcgacatgcgccgccatccggcgggcgcgccgctcgtcgattcg
atcaagcgcggcttcgtctattcggacggctgggtcgacgatgcgcggctcgtcgtgctg
aacgcgctcgatgcgcaagagcgcggcgcgcgcatcctcacgcgcacgaagctcgtgtcg
gccgagcgccgcgacgggcaatggcatgcacgactgcaacgcgccgacggctcgacgctc
gacgtgcgggcgcgcgcgatcgcgaacgcggcgggcccgtgggtcggcgaagtgctgcac
ggcgcgctcggccgcggcgcgcagcatagcgtgcgcctcgtgaagggcagccatatcatc
acgccgcgcctgttcgatcacgaccacgcgtacatcttccagaatccggacaagcgcatc
atcttcgcgattccgtacgaacgcgacttcacgctgatcggcacgaccgacgtcgaatac
cgcgacgatccgtcgcgcgtcgcgatcgaccgcgacgaaacgcgctatctgtgcgagtcg
atcaaccgctatttcaagcgtaagatctcgcccgccgacgtatgctggacctactccggc
gtgcgcccgctgctcgaggacgagaacgcggacaacccgtccgccgtcacgcgcgactac
cgcctcgagctcgacgacggcgaaggcgcgccgctgctgtcggtgttcggcggcaagatc
acgacgtttcgcaagctcgccgaagaggcgaccgacatgctgggcggcgcgctcggcgcg
gcgcgcggcgcatggacggcgggggtgccgctgccgggcggcgacatcgcgaacgcgcgc
ttcgcgccgttcgccgaggcgttcgcgaaacgccacccgtggctgcccgccgcgctcgcg
cgccgctatgcgcgcgcgtacggcacgcgcgccgagcgcgtgatcgggcgagcccggtcg
cacgccgagctcggcgtgcagctcgcgcccggcctctacgaagcggaattgcgttatctg
cgcgacgtcgaatgggcgggttgcgcggacgacgtgctgtggcggcgttcgaagctcggc
ctgcatgtcgcgccgggcacgctcgagcccgtgacggccgcgctcgacgcctggttcggc
gccgcgcgcgaagcggcgagcgccgcgcactga

DBGET integrated database retrieval system