KEGG   Burkholderia mallei ATCC 23344: BMA1218Help
Entry
BMA1218           CDS       T00204                                 

Gene name
nodI
Definition
(RefSeq) nodulation ABC transporter NodI
  KO
K09695  lipooligosaccharide transport system ATP-binding protein
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bma00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMA1218 (nodI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bma02000]
    BMA1218 (nodI)
Transporters [BR:bma02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipooligosaccharide transporter
    BMA1218 (nodI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_22 AAA_23 T2SSE AAA_29
Motif
Other DBs
NCBI-GeneID: 3089978
NCBI-ProteinID: YP_102897
UniProt: Q62K72
LinkDB All DBs
Position
1:1278968..1279888
Genome map
AA seq 306 aa AA seqDB search
MPMSVAPIDFQQVEKRYDDKLVVDGLSFHVQPGECFGLLGPNGAGKTTTLKMLLGITHPD
AGSISLCGEPVPSRARHARQRVGVVPQFDNLDPDFTVRENLLVFARYFGLTAHAARALVP
PLLEFAKLESKADAKVGELSGGMKRRLTLARALVNDPDVLVLDEPTTGLDPQARHLMWER
LRSLLARGKTILLTTHFMEEAERLCHRLCVIEEGRKIAEGAPRMLIEAEIGCDVIEIYGP
DPVQLRDELAPFAERTEISGETLFCYVDNPEPIHARLKGRAGLRYLHRPANLEDVFLRLT
GREMLD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatgtctgtcgcacccatcgattttcaacaagtcgagaaacgctacgacgacaag
ctcgtcgtcgacggtttgtcgtttcacgtgcagcccggcgaatgcttcggtctgctcggc
ccgaacggcgcaggcaagacgacgacgctcaagatgctgctcggcatcacgcaccccgac
gcaggttcgatcagtctgtgcggcgaacccgtgccgtcccgcgcgcggcacgcgcggcag
cgcgtcggcgtcgtgccgcagttcgacaatctcgatcccgacttcaccgttcgcgagaac
ctgctcgtgttcgcccgctacttcggactgaccgcccacgcggcgcgcgcgctcgtgccg
ccgctgctcgagttcgcgaagctcgaaagcaaggcggacgcgaaggtgggcgagctctcg
ggcgggatgaagcggcggctcacgctcgcgcgcgcgctcgtcaatgatcccgacgtgctc
gtgctcgacgagccgacgacgggcctcgatccgcaagcccggcacctgatgtgggagcgg
ctgcgctcgctgctcgcgcgcggcaagacgattctgctcaccacgcacttcatggaagag
gccgagcgtttgtgccatcgcctgtgcgtgatcgaggaaggccgcaagattgcggaaggc
gcgccgcgcatgctgatcgaagcggaaatcggctgcgacgtgatcgagatctacgggccc
gatcccgtacagcttcgcgacgagctcgcgcccttcgccgagcgcaccgagatcagcggc
gaaacgctcttttgctacgtcgacaatccggagccgatccacgcgcgcctgaaaggccgc
gccggcctgcgctatctgcaccgccccgcgaatctcgaagacgtattcctgcggctgacc
ggccgcgagatgctggattga

DBGET integrated database retrieval system