KEGG   Burkholderia mallei ATCC 23344: BMA1802Help
Entry
BMA1802           CDS       T00204                                 

Definition
(RefSeq) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BMA1802
Enzymes [BR:bma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BMA1802
Transporters [BR:bma02000]
 Other Transporters
  Pores ion channels [TC:1]
   BMA1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 3090766
NCBI-ProteinID: YP_103408
UniProt: A0A0H2WJM9
LinkDB All DBs
Position
1:complement(1893980..1894612)
Genome map
AA seq 210 aa AA seqDB search
MSNYYNKVKFVLLEHDIPFEASIVSVPIKDPAFLADTPLGKVPYLMTEHGSLCESQAIIE
YLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWNVRELFPEAFFGGKVSDGTKAHVEK
RMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHLPVVALATKAIYGRDFVVDAGIDWKA
YVKRIEEARPAAKRVSDERKAFVAGLAKPG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaattattacaacaaggtcaagttcgtcctgctcgagcacgacattccgttcgaa
gcgtcgatcgtcagcgtcccgatcaaggaccccgcgtttttggccgatacgccgctcggc
aaggtgccgtatctgatgaccgagcacggctcgctgtgcgaatcgcaggcgatcatcgaa
tatcttgccgcgattcatcccgacaagcccattttcccggccgatccgttcgcggcggcg
aaggcgcgcgagatcacggcggtgctcgagctgtacctcgaatggaacgtgcgcgaactg
tttccggaggcgttcttcggcggcaaggtgagcgacggcacgaaggcgcacgtcgagaag
cgcatgccgcgcgcgctggacggtttcaagcggctcgcgaaattttcgccgtacgtgctc
ggcgatacgttctgcattgccgacatcgccgcgttcatccatctgccggtcgtcgcgctc
gcgacgaaggcgatctacggccgcgatttcgtcgtcgacgcggggatcgactggaaggcg
tacgtgaagcgcatcgaggaagcgcggccggccgcgaagcgcgtgagcgacgagcgcaag
gcgttcgtcgcggggctcgcgaagccgggctga

DBGET integrated database retrieval system