KEGG   Burkholderia mallei ATCC 23344: BMA2271Help
Entry
BMA2271           CDS       T00204                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bma  Burkholderia mallei ATCC 23344
Brite
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BMA2271 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 3089730
NCBI-ProteinID: YP_103834
UniProt: A0A0H2WL58
LinkDB All DBs
Position
1:complement(2356335..2357000)
Genome map
AA seq 221 aa AA seqDB search
MRGYSDSPTIGRSAASNTALPTYTSKEPIMAHTLPPLPYAEDALAPHISQETIQFHYGKH
HQAYVTNLNNLIPGTEFENLPLEEIVKKSSGGIFNNAAQIWNHTFFWNSLSPNGGGAPTG
ALGDAINAKWGSFDAFKEAFTKAAVGTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADK
PLVTIDVWEHAYYIDYRNARPKFVEAFWNIVNWDFAAKNFA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgcggggttattcggactcgcctacaatcgggcgttccgcggcatccaacactgccctc
cctacatacacttcgaaggaaccgatcatggctcatacgctcccgccgctgccgtacgct
gaagacgccctcgctccgcatatctcgcaggagacgatccagtttcactacggcaagcat
caccaggcttatgtgacgaacctgaacaacctgatccccggcaccgagttcgagaacctg
ccgctggaagagatcgtgaagaagtcgtcgggcggcatcttcaacaacgccgcgcagatc
tggaatcacacgttcttctggaacagcctgtcgccgaacggcggcggcgcgccgacgggc
gcgctcggcgacgcgatcaacgcgaagtggggttcgttcgacgcgttcaaggaggcgttc
acgaaggcagcggtcggcacgttcggctcgggctgggcttggctcgtgaagaaggcggac
ggctcgctcgacatcgtgtcgacgagcaatgcggccacgccgctcacgacggccgacaag
ccgctcgtcacgatcgacgtgtgggaacacgcttactacatcgattaccgcaacgcgcgc
ccgaagttcgtcgaagcgttctggaacatcgtgaactgggacttcgccgcgaagaacttc
gcgtaa

DBGET integrated database retrieval system