KEGG   Burkholderia mallei ATCC 23344: BMA2537Help
Entry
BMA2537           CDS       T00204                                 

Definition
(RefSeq) NUDIX family pyrophosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bma03400]
    BMA2537
Enzymes [BR:bma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BMA2537
DNA repair and recombination proteins [BR:bma03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BMA2537
 Prokaryotic Type
    BMA2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-GeneID: 3088691
NCBI-ProteinID: YP_104080
UniProt: A0A0H2WLM5
LinkDB All DBs
Position
1:complement(2640650..2641099)
Genome map
AA seq 149 aa AA seqDB search
MSGEVTNAAAPAATGRKVTEVAVGVLVRPDGRYLLAQRLIGKPYEGYWEFPGGKLEAGES
VEAALARELHEELGIAVTECHRWHTLEHDYPHAYVRLYFCKVTGWTGEPHSREGQAFVWQ
HLPVDVAPLLPAALPVLELLAREQGDAQQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgaagtcacgaacgcggcggcgcccgccgccacgggccgcaaggtgaccgag
gtggcggtcggtgtgctggtgcggcctgacggccggtacctgctcgcgcagcggttgatc
ggcaagccttacgaagggtactgggaatttccggggggcaagctcgaggcgggcgagagc
gtcgaggcggcgctcgctcgcgaactgcacgaggaactgggtatcgccgtgaccgaatgc
catcgctggcacacgctcgagcacgactatccgcacgcatacgtccgtctgtacttctgc
aaggtgacggggtggacaggcgagccgcacagccgggaggggcaggcgttcgtctggcag
catttgccggtcgacgtcgcaccgctgctgcccgccgcactgcccgtgctcgagttgctc
gcgcgcgagcagggcgacgcgcagcaataa

DBGET integrated database retrieval system