KEGG   Burkholderia mallei ATCC 23344: BMA2549Help
Entry
BMA2549           CDS       T00204                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00473  D-Alanine metabolism
bma00550  Peptidoglycan biosynthesis
bma01100  Metabolic pathways
bma01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMA2549 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMA2549 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BMA2549 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bma01011]
    BMA2549 (ddl)
Enzymes [BR:bma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BMA2549 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bma01011]
 Precursor biosynthesis
  Amino acid ligase
   BMA2549 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-GeneID: 3088105
NCBI-ProteinID: YP_104092
UniProt: Q62GS9
LinkDB All DBs
Position
1:complement(2652953..2653891)
Genome map
AA seq 312 aa AA seqDB search
MSGIDPKRFGKVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDYAARAQDIVAKLGVPLFVKPASEGSSVAVEKVKSADALPAALEEAAKHDKI
VIVEKSIEGGGEYTACIAADLDLPLIRIVPAGEFYDYHAKYIANDTQYLIPCGLDAAKEA
EFKRIARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGIGYS
ELVVKVLSLTLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgctgctcggcggggattcc
gccgagcgcgaggtatcgctgaactctggccggctggtgctgcagggcctgcgcgacgcg
ggcatcgacgcgcatccgttcgatccggcgcagcggccgctcgcggcgctcaaggacgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaagttccgcacgaagctcgtctggcagcagacgggcattccgacgccgccg
ttcgagacggtgatgcgcggcgacgattatgcggcgcgcgcgcaggacatcgtcgcgaag
ctcggcgtgccgcttttcgtgaagccggcgagcgagggctcgagcgtcgcggtcgagaag
gtgaaaagcgccgatgcgttgcccgccgcactggaagaagcggcgaagcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccgcggat
ctcgatctgccgctcatcaggatcgtgcccgcgggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcaatacctgattccgtgcggcctcgacgcggcaaaggaagcc
gagttcaagcgcatcgcgcgccgcgcgttcgacgtgctcggctgcacggactggggccgc
gcggatttcatgctcgacgccgcgggcaacccgtatttcctcgaagtgaacaccgcgccg
gggatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtgggcatcggctattcg
gagctggtggtgaaagtgctgtcgctcacgctcgattga

DBGET integrated database retrieval system