KEGG   Burkholderia mallei ATCC 23344: BMAA1076Help
Entry
BMAA1076          CDS       T00204                                 

Definition
(RefSeq) zinc-binding dehydrogenase family oxidoreductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00040  Pentose and glucuronate interconversions
bma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMAA1076
Enzymes [BR:bma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BMAA1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 3086972
NCBI-ProteinID: YP_105739
UniProt: A0A0H2WCK1
LinkDB All DBs
Position
2:1118170..1119204
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARELALRDIDLPLEVGPADVKIRVHTVGVCGSDVHYYMHGGIGPFRVDAPMV
LGHEASGTVVEVGRDVTYLRVGERVCMEPGVPRFDSKATLHGLYNLDPSVRFWATPPVHG
CLAPYVVHPAAFTYRLPPNVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFAANRAVTTVDASTQSLADAVAHATDGWGADVVFE
ASGNANAYAGIVDLLCPNGCLVLVGMPLAPVPLDVVSLQAKEARIESVFRYANVFPRALA
LIASGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgagctcgcgctgcgcgacatcgatctgccg
ctcgaggtcggccccgccgacgtcaagatccgcgtccacacggtgggcgtgtgcggcagc
gatgtccattactacatgcacggcggaatcggcccgttccgggtggacgcgccgatggtg
ctcggccacgaggcgtcgggcacggtcgtcgaggtcgggcgcgacgtcacgtacctgcgc
gtgggcgagcgcgtgtgcatggagcccggcgtgccgcgcttcgattcgaaagcgacgctg
cacggcctgtacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggg
tgcctcgcgccctacgtcgtgcacccggcggcgttcacgtaccggctgccgccgaacgtg
tcgttcgccgagggcgcgatcgtcgagccgctcgcgatcgggctgcaggccgcgaagaag
gcggcgatgaagccgggcgacatcgcggtggtcgtcggcgcgggcacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgatcctcgccgacgtcgtcaag
gaaaagctcgcgctgttcgccgcgaaccgcgcggtgacgacggtcgacgcgagcacgcag
tcgctcgccgacgcggtcgcgcacgcgaccgacggctggggcgcggacgtggtgttcgag
gcgagcggcaacgcgaacgcgtatgcgggcatcgtcgatctgctgtgcccgaacggctgc
ctcgtgctggtcggcatgccgctcgcgccggtgccgcttgatgtcgtttcgctgcaggcg
aaggaggcgcgcatcgaatcggtgttccgctacgcgaacgtcttcccgcgcgcgctcgcg
ctgatcgcctccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttctcg
gacggcctgcgcgcattcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system