KEGG   Burkholderia mallei ATCC 23344: BMAA1480Help
Entry
BMAA1480          CDS       T00204                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
bma00250  Alanine, aspartate and glutamate metabolism
bma00410  beta-Alanine metabolism
bma00640  Propanoate metabolism
bma00650  Butanoate metabolism
bma01100  Metabolic pathways
bma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BMAA1480 (gabT)
   00650 Butanoate metabolism
    BMAA1480 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMAA1480 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMAA1480 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bma01007]
    BMAA1480 (gabT)
Enzymes [BR:bma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BMAA1480 (gabT)
Amino acid related enzymes [BR:bma01007]
 Aminotransferase (transaminase)
  Class III
   BMAA1480 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 3085986
NCBI-ProteinID: YP_106079
UniProt: A0A0H2WDS2
LinkDB All DBs
Position
2:1611120..1612403
Genome map
AA seq 427 aa AA seqDB search
MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPR
IVKAIADQLGQFTHTAYQIVPYASYVELAEKINARAPIAQPKKTAFFTTGAEAVENAVKI
ARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPGDVFHAPYPNALHGVTSA
DSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKLCDAHGILLIADEV
QTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAELPQIVDVRGPGAMVAAEFVD
PHTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIEDAVFDEALGILESVLR
EAVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgccgatctgcacgcccgcaagaacgccgcgacgccgcgtggcgtcggcgtg
atgtgcgatttctacgccgcgcgcgccgagaacgccgagctgtgggatgtcgagggccgc
cgcttcatcgatttcgcggccggcatcgcggtcctgaacacgggccatcgccatccgagg
atcgtgaaggcgatcgccgaccagctcgggcaattcacgcataccgcgtatcagatcgtg
ccgtacgcgtcgtacgtcgaactcgccgagaagatcaacgcgcgcgcgccgatcgcgcag
ccgaagaagaccgcgttcttcacgacgggcgcggaagcggtcgagaacgcggtgaagatc
gcgcgcgcctacaccggccggccgggcgtgatcgcgttcgcgggcggcttccacggccgc
acgatgatgggcatggcgctcaccggcaaggtcgcgccgtacaagatcggcttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcgttgcacggcgtgacgagcgcc
gattcgatcgcggccgtcgaaacgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgagccggtgcagggcgaaggcggcttcaacccggcgcccgccgagttc
gtgcgcgcgctgcgcaagctgtgcgacgcgcacggcattctcctcatcgccgacgaagtg
cagacgggcttcgcgcgcacgggcaagctgttcgcgatggagcactacgacgtctcggcc
gacctgatgacgatcgcgaagagcctcgcgggcgggatgccgctgtcgggcgtcgtcggc
cgcgcggacgtgatggacgcggccgcgccgggcggcctgggcggcacgtacgcgggcaat
ccgctcgccgtggccgccgcgcacgcggtgctcgacgtgatcgacgaggagaagctcgcc
gagcgcgcgaccgtgctcggcgacaagctgaaggcgaagctcgccgcgctgcgcgccgag
ctgccgcagatcgtcgacgtgcgcggcccgggcgcgatggtcgccgcggaattcgtcgat
ccgcacacgcgcgcgtccgatgccgcgttcacgaagcgcgtgcagacgctcgcgctcgag
cgcgggctgctgctgctcatctgcggcgtcgacgcgaacgtgatacgtttcctgtttcct
ctcaccatcgaggatgccgtgttcgacgaagcgctcggcattctcgagagcgtgctgagg
gaagcggtgggcgtgcccgcctga

DBGET integrated database retrieval system