KEGG   Burkholderia mallei ATCC 23344: BMAA1774Help
Entry
BMAA1774          CDS       T00204                                 

Definition
(RefSeq) Bcr/CflA family drug resistance transporter
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bma  Burkholderia mallei ATCC 23344
Brite
KEGG Orthology (KO) [BR:bma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bma02000]
    BMAA1774
Transporters [BR:bma02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BMAA1774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 TRI12 Sugar_tr MFS_4
Motif
Other DBs
NCBI-GeneID: 3087434
NCBI-ProteinID: YP_106333
UniProt: A0A0H2W9S5
LinkDB All DBs
Position
2:complement(1938201..1939388)
Genome map
AA seq 395 aa AA seqDB search
MSDRGWLSLLMLVVCLPRMTIDAYLPSLPAMADALHGTDAQMQLTLTMYMAGYALSMLLS
GPLSDRYGRRPVLLAGMLVYLGASVACATATSVQGIVVARIGQALGGCCGTVIGRVIVRE
RFGTAMQAAMLSRISAGMALSPVVAPLAGHVVAQWLGWRGVFALLAFGGGAAALMVHRFL
PETRVRAAASERGAGLAKTYLSLLRDRRFVRYSLAIGFVYCTYFPFIAESSALFQRTLRA
SGAVYAAIFGITVLGYLIGSSVFRRASGRFGIDAIIASAAFVNLVGAAALWIGTSVAPPS
VWSIALPMFVVMVSVGVSIPACQFAVLQPFAKLAGTASGLFFFIQMAMTAGCGGMLSRLS
DGSARPMAVVTAASSAAFMAVVMLVRTRGVNGRRG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgaccggggctggctaagcctgctgatgctcgtcgtctgcttgccgcgcatgacg
atcgacgcatatctgccgtcgctgcccgcgatggcggacgcgcttcacggcaccgacgcg
cagatgcaactgacgctcacgatgtacatggccggctacgcactgtcgatgctgctatcc
gggccgttgtccgaccgttacgggcgcaggccggtgctgctcgccggcatgctcgtgtat
ctcggcgcgagcgtcgcatgcgcgacggcgacgagcgttcagggcatcgtcgtcgcgcgg
atcggccaggcgctgggcggctgctgcggcaccgtgatcggccgcgtgatcgtccgcgaa
cgcttcggtacggcgatgcaagcggcgatgctcagccggatatcggcgggcatggcgttg
tcgcccgtcgtcgcgccgcttgccggccacgtcgtcgcgcagtggctcggctggcgcggc
gttttcgcgttgctcgcgttcggcggcggcgccgccgcgctgatggtgcatcgctttctg
ccggagacccgcgtgcgcgcggcggcgagcgaacgcggcgcgggcctggcgaagacttac
ctgtcgctgcttcgcgaccgccggttcgtgcgttactcactcgcgatcggcttcgtctat
tgcacgtattttccgttcatcgccgaatcgtctgcgctgtttcaacgcacgcttcgcgcc
tccggcgctgtctatgcggcgatattcgggatcacggtgctcggctacctgatcggctcg
agcgtgtttcgccgggcgagcggccggttcggaatcgatgcgatcatcgcgtcggccgcc
ttcgtcaatctagtcggcgcggccgcgctgtggatcgggacgtcggtcgcgccgccgagc
gtctggtcgatcgcgttgccgatgttcgtcgtcatggtgtcggtcggcgtttcgatcccg
gcgtgccagttcgcggtgctgcagccgttcgcgaagctcgcgggcaccgcttccggattg
ttcttcttcattcagatggcgatgacggccgggtgcggcgggatgctgagccggctgtcc
gacggctccgcgcggccgatggccgtcgtcaccgccgcatcgagcgcggcgttcatggcc
gtcgtcatgctcgtgcgaacgcgcggcgtgaacggtcggcgcggttga

DBGET integrated database retrieval system