KEGG   Burkholderia mallei 2002734299: BM45_1635Help
Entry
BM45_1635         CDS       T03872                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00030  Pentose phosphate pathway
bmab00710  Carbon fixation in photosynthetic organisms
bmab01100  Metabolic pathways
bmab01110  Biosynthesis of secondary metabolites
bmab01120  Microbial metabolism in diverse environments
bmab01130  Biosynthesis of antibiotics
bmab01200  Carbon metabolism
bmab01230  Biosynthesis of amino acids
Module
bmab_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bmab_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BM45_1635 (rpiA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BM45_1635 (rpiA)
Enzymes [BR:bmab01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BM45_1635 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A Sugar-bind DeoRC
Motif
Other DBs
NCBI-ProteinID: AJX03825
UniProt: A0A3N4FTZ2
LinkDB All DBs
Position
1:1792399..1793094
Genome map
AA seq 231 aa AA seqDB search
MTQDELKRLVGEAAARYVTENVPQGAVIGVGTGSTANCFIDALAAVKDRYRGAVSSSVAT
TERLKSHGIKVFDLNEIESLQVYVDGADEIDGSGAMIKGGGGALTREKIVASVAETFVCI
ADASKRVAVLGQFPLPVEVVPMARTAIGRRLAALGGVPVLRVKQDGAPYVTDNGNEILDV
KGLRIDDPRALEAAINGWPGVVTVGLFAQRGADLCLLGTERGVETLRYAAH
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagacgaactcaaacgcctcgtcggcgaggccgctgcccgatacgtgaccgaa
aacgtgccgcagggcgcggtgatcggcgtcggcacgggctcgaccgccaactgcttcatc
gatgcgctcgcggccgtcaaggatcgctatcgcggcgcggtgtcgagttcggtggcgacg
accgagcgcctgaagtcacacggcatcaaggtgttcgatctgaacgagatcgaatcgctg
caggtgtatgtcgacggcgccgacgagatcgacgggagcggcgcgatgatcaagggcggc
ggcggcgcgctcacgcgcgagaagatcgttgcttcggttgccgaaacgttcgtgtgcatc
gccgatgcgagcaagcgcgtggcggtgctcggccagttcccgctgcccgtcgaggtggtg
ccgatggcgcgcaccgcgatcggccgccggctcgccgcgctgggcggcgtgcccgtgctg
cgcgtgaagcaggacggcgcgccgtacgtgaccgacaacggcaacgagattctcgacgtg
aagggcctgcggatcgacgatccgcgcgcgctcgaagcggcgatcaacggctggcccggc
gtcgtgacggtcgggctgttcgcgcaacgcggcgcggatctctgcctgctcggcaccgag
cgcggcgtcgagacgctccgttacgctgcgcattaa

DBGET integrated database retrieval system