KEGG   Burkholderia mallei 2002734299: BM45_2137Help
Entry
BM45_2137         CDS       T03872                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BM45_2137
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmab02000]
    BM45_2137
Enzymes [BR:bmab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BM45_2137
Transporters [BR:bmab02000]
 Other Transporters
  Pores ion channels [TC:1]
   BM45_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AJX03035
UniProt: A0A381BEZ9
LinkDB All DBs
Position
1:complement(2371501..2372157)
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLLEHDIPFEASIVSVPIKDPAFLADTPLGKVPYLMTEHGSL
CESQAIIEYLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWNVRELFPEAFFGGKVSD
GTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHLPVVALATKAIYGRDFVV
DAGIDWKAYVKRIEEARPAAKRVSDERKAFVAGLAKPG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctttgtggttttccagtgtccaattattacaacaaggtcaagttcgtcctg
ctcgagcacgacattccgttcgaagcgtcgatcgtcagcgtcccgatcaaggaccccgcg
tttttggccgatacgccgctcggcaaggtgccgtatctgatgaccgagcacggctcgctg
tgcgaatcgcaggcgatcatcgaatatcttgccgcgattcatcccgacaagcccattttc
ccggccgatccgttcgcggcggcgaaggcgcgcgagatcacggcggtgctcgagctgtac
ctcgaatggaacgtgcgcgaactgtttccggaggcgttcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctggacggtttcaagcggctc
gcgaaattttcgccgtacgtgctcggcgatacgttctgcattgccgacatcgccgcgttc
atccatctgccggtcgtcgcgctcgcgacgaaggcgatctacggccgcgatttcgtcgtc
gacgcggggatcgactggaaggcgtacgtgaagcgcatcgaggaagcgcggccggccgcg
aagcgcgtgagcgacgagcgcaaggcgttcgtcgcggggctcgcgaagccgggctga

DBGET integrated database retrieval system