KEGG   Burkholderia mallei 2002734299: BM45_2719Help
Entry
BM45_2719         CDS       T03872                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00550  Peptidoglycan biosynthesis
bmab01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BM45_2719
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BM45_2719
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmab01011]
    BM45_2719
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmab03036]
    BM45_2719
Enzymes [BR:bmab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BM45_2719
Peptidoglycan biosynthesis and degradation proteins [BR:bmab01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BM45_2719
Chromosome and associated proteins [BR:bmab03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BM45_2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AJX01727
LinkDB All DBs
Position
1:complement(3002661..3004505)
Genome map
AA seq 614 aa AA seqDB search
MKPASKRTQGVKFASSPVLSVHLPMWRSKLVVFMLFIAFVALAMRAFWIQGPGNAFYQKQ
GESRYQRTLELPATRGKILDRNGLVLATSLPVRAIWAIPADVPDDLGADKLDALGKLLGM
TTKELKAKLSEDKTFVYVKRQVPLDVAEQVAKLDIPGVYQRGEYKRFYPEGEITAHLIGF
TNVEDEGQEGVELADQKLLVGTPGSRHVIKDRVGHIVEDVDAQVPPHNGADVGLSIDSKI
QYITYTNLKAAVEKFHAKAGAAMVIDVQTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLT
DVFEPGSIMKPFTVSLALDLHRVTPNTLVETGNGHFVLDGAPITDDSGFGTLTVGGVIQK
SSNIGATKIAMTMKPEEMWNMYTGIGLGQAPKVGFPGAAAGRLRPWKNWRRIEQATMSYG
YGLSVSLFQLARAYTAIAHDGELMPVTIFKTNDAQPPTGPRVFSPTTAREVRTMLESVVS
PQGTSPNAAVPGYRVGGKSGTAYKQVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPT
TGGHFGGQVSGPVFSAIVGDTLRALNVPPNMPVKQLVVSDDATNAAAAQKLAANAPAKRL
IVSSTTHNRPGVVR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcttcgaagcgcacgcaaggcgtgaagttcgcatcgagcccggtgctgtcg
gttcatctgccgatgtggcgctcgaagcttgtcgtgttcatgctgttcatcgctttcgtc
gcgctcgcgatgcgcgcgttctggatccaggggccgggcaacgcgttctatcagaaacag
ggcgaaagccgctatcagcgcacgctcgagttgccggcgacgcgcggcaagatcctcgat
cgcaacggcctcgtgctcgcgacgagcttgcccgtgcgcgcgatctgggcgattccggcc
gacgtgcccgacgacctcggcgcggacaagctcgacgcgctcggcaagctgctcgggatg
acgacgaaggagctgaaggcgaagctctcggaagacaagacgttcgtctacgtgaagcgc
caggtgccgctcgacgtcgccgagcaggtcgcgaagctcgacattcccggcgtctatcag
cgcggcgaatacaagcgcttctacccggaaggcgagatcaccgcgcacctgatcggtttc
acgaacgtcgaggacgaggggcaggagggcgtcgagctcgccgaccagaagctgctcgtc
ggcacgccgggcagccgccacgtgatcaaggaccgcgtcgggcacatcgtcgaggacgtc
gatgcgcaggtgccgccgcacaacggcgccgacgtcggcctgtcgatcgacagcaagatc
cagtacatcacgtatacgaacctgaaggcggccgtcgagaaattccacgcgaaggcgggc
gcggcgatggtgatcgacgtgcagacgggcgaggtgctgtcgctcgtcaattatccgacg
tataacccgaacgaccgctcgcacctgacgggcgagcagttgcgcaatcgcgtgctgacc
gacgtgttcgagccgggctcgatcatgaagccgttcacggtctcgctcgcgctcgatctg
catcgcgtgacgccgaacacgctcgtcgagacgggcaatggccatttcgtgctcgacggc
gcgccgatcaccgacgattcgggcttcggcacgctgaccgtcggcggcgtgatccagaaa
tcgagcaacatcggcgcgacgaagatcgcgatgacgatgaagcccgaggaaatgtggaat
atgtatacaggcatcgggctcggacaggcgccgaaggtcggctttcccggcgcggcggcg
ggccgcctgcgcccgtggaagaactggcggcgcatcgagcaggcgacgatgtcgtacggc
tacggcctgtcggtgtcgctgttccagctcgcgcgcgcatacaccgcgatcgcgcacgac
ggcgaactgatgcccgtgacgattttcaagacgaacgacgcgcaacccccgacgggcccg
cgcgtcttctcgccgacgacggcccgcgaagtgcgcacgatgctcgaatccgtcgtgtcg
ccgcagggtacgtcaccgaatgcggcggtgcccggctatcgcgtcggcggcaagagcggt
accgcttacaagcaggtcggccgcggctatgatcacaagaagtatcgcgcgtcgttcgtc
gggatggcgccgatgccgaacccgcgcatcgtcgtcgccgtgtcggtcgacgaaccgacg
acgggcggccacttcggcggccaggtgtcgggccccgtattctccgcgatcgtcggcgat
acgctgcgcgcgctgaacgtgccgcccaacatgccggtcaagcagctcgtcgtgtcggat
gatgcgacgaacgccgccgccgcgcaaaagctggccgcgaatgcgccggcgaaacgcctg
atcgtgtcgagcacgacacacaaccgtcctggagtagttcgatga

DBGET integrated database retrieval system