KEGG   Burkholderia mallei 2002734299: BM45_3164
Entry
BM45_3164         CDS       T03872                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bmab  Burkholderia mallei 2002734299
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmab02044]
    BM45_3164
Secretion system [BR:bmab02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BM45_3164
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AJX04550
UniProt: A5PM47
LinkDB
Position
2:complement(48245..49267)
AA seq 340 aa
MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDV
ERIDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPL
LFDAWLKHRLALRIVEERDEHALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRS
AAGLRALLADAFAPATVDIEPCVSQWLPIPDDQRTRVGTRARRLGADARVGARMRDDGAR
LRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAVDVVVRVRARDAAPARCGRRA
WSRVGLDAWLGGPSAERAASPKFRLPTSLFDQARPHHAAG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcctgctctagaacccgttctgctcggcgaggcgaagcacttcgcgtatttccaggcg
atccggctgctgcggcgcatcgcgcgcgaacggcgcggcgacgccgcggggcggcccgac
gcgccgctgccgatccacacgcggccgaatctctcgctgtcgtttccggacaccgacgtc
gagcgcatcgacaaggccgacgacggcggctaccgggtcgtcgcgaacttcttcggtctg
tacggcgtgtcctcgccgctgccgacgttctacaccgaggacctgatcgacgaagcgttc
aggggccgccacgcggcgcgcggctttctcgacgtgctgcatcgcgcgctctatccgctg
ctgttcgacgcgtggctcaagcatcggctggcgctgcggatcgtcgaggaacgcgacgaa
cacgcgctgcgcccgctctacgcactcgcgggcgtcgacgcgcgcatcgcgcgcgacgcg
ggcctgcacgagcacgcgctgctgcgctacgtcgggctgctcagccagcggccgcgctcc
gcggccggtctgcgcgcgctgctcgccgacgcgttcgcgcccgcgacggtcgacatcgag
ccgtgcgtgtcgcaatggctgccgattccggacgaccagcgcacccgcgtcggcacgcgc
gcgcgccggctcggcgccgacgcgcgggtcggcgcgcgcatgcgcgacgacggcgcccgg
ctgcggatcgtgctcggcgacgtgcccggcccgctgttccgcgcgctgatgccgggcggc
gatgcgtttgcccggctgcgcttgctcgtacgcctgtatctgacccaaccgttcgccgtg
gacgtcgtggtgcgcgtgcgcgcgcgcgacgcggcccccgcgcgctgcggccgccgcgcg
tggtcgcgcgtcgggctcgacgcgtggctgggcggcccgagcgcggaacgcgcggcgtcg
cccaaattccgtcttccgacttccctctttgatcaagcgagaccccatcatgctgctggt
tga

DBGET integrated database retrieval system