KEGG   Burkholderia mallei 2002734299: BM45_3289Help
Entry
BM45_3289         CDS       T03872                                 

Definition
(GenBank) aminotransferase class I and II family protein
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00270  Cysteine and methionine metabolism
bmab00450  Selenocompound metabolism
bmab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BM45_3289
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BM45_3289
Enzymes [BR:bmab01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     BM45_3289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Met_gamma_lyase Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJX05504
UniProt: A0A3N4FDB0
LinkDB All DBs
Position
2:191015..192316
Genome map
AA seq 433 aa AA seqDB search
MTYSSYHKKDIEGRPLHPETQMMSYGFDPFLSEGAVKPPVFLTSTFAFRSAEDGADFFDI
VSGRKPLPQGEAAGLVYSRFNHPNLEIVEDRLALLDGSEAAVVTSSGMSAISAIFLAFLR
PGDQLVQSVPLYGGTETLIAKYFREWGVGAHSIDNGLSPQAIGAALEAAAQQGPVRLCYV
ETPANPTNALIDLDGMRRELDAFEARHGYRPISVCDNTLLGPIFQKPSEHGVDMSVYSLT
KYVGGHSDLVGGGVTGRRDLVAKVRAVRSAFGSQLDPHSSWMLIRSMETVVLRMKQAART
ASAVAKWLATNPHQKVDVYHPELIVDDAYQAVYKRQCTGAGSTFAFVLNGGRAEAFRFIN
ALHLFKSAVSLGGTESLICHPASTTHSGVPEAARKAAGVSEGLIRVSIGLEHEEDLIADL
DHAFRRSGLATGV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacgtattcgagctatcacaagaaggacatcgagggccgtccgctgcacccggaaacg
cagatgatgtcgtacggattcgatccgttcttgtccgaaggcgcggtgaagcctccggta
ttcctcacgtcgacgttcgcgttccgctcggcggaggacggcgccgatttcttcgatatc
gtctcgggccgcaagccgttgccgcagggcgaggcggcgggcctcgtctacagccgcttc
aatcatccgaatctcgagatcgtcgaggatcgcctcgcgctgctcgacggctccgaggcg
gccgtcgtcacgtcgagcgggatgtcggcgatcagcgcgatctttctcgcgttcctgcgg
ccgggcgatcagctcgtgcaatcggtgccgctgtacggcggcacggaaacgctgatcgcg
aaatacttccgcgaatggggtgtcggcgcgcattcgatcgacaacggcctgtcgccgcaa
gcgatcggcgcggcgcttgaagccgccgcgcagcaggggcccgtgcggctctgctacgtc
gagacgccagcgaatccgacgaacgcgctgatcgacctcgacggcatgcgccgcgagctc
gacgcgttcgaggcgcgacacggctatcgtccgatttcggtgtgcgacaacacgctgctc
gggccgatcttccagaagccgagcgagcacggcgtcgacatgtcggtgtactcgctgacc
aagtacgtcggcggccacagcgatctcgtcgggggcggcgtgacggggcggcgggatctc
gtcgcgaaggtccgcgcggtgcgcagcgcattcggctcgcagctcgatccgcattcgtcg
tggatgctgatccgttcgatggaaacggtcgtgctgcggatgaagcaggcggcgcgcacc
gcgtcggcggtcgcgaagtggctcgcgacgaatccgcatcagaaggtcgacgtgtaccac
ccggagctgatcgtcgacgatgcgtatcaggccgtgtacaagcggcaatgcacgggcgcc
ggctcgacgttcgcgttcgtgctgaacggcggccgcgcggaagcattccgcttcatcaac
gcgttgcatctgttcaagtccgcggtgagtctcggcggcaccgaatcgttgatctgccat
ccggcgtcgacgacgcactccggcgtgccggaggcggcgcgcaaggcggcgggcgtgtcg
gaagggttgattcgcgtgtcgatcgggctcgagcacgaggaggacctgatcgccgatctc
gatcacgcgtttcgccggtccggcctcgcgacgggcgtctga

DBGET integrated database retrieval system